CAZyme Information: MGYG000002033_02192

Basic Information

• Species: Parabacteroides massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides massiliensis
• CAZyme ID: MGYG000002033_02192
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
886		101251.45	6.5574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002033	4100607	MAG	Spain	Europe

• Gene Location: Start: 4007; End: 6667 Strand: +

Full Sequence      

MKKEMLLTVALCFSGSLSAQHKIDLSKINPPAINYLELGHTGPVGKEIRVNNLYMDEGGI
PQLPVMGEIHYNRMDHRYWRDALLKMKASGINIVATYCIWSLHEEVEGELSWEGHLNLRH
FIELCKELDLKVHLRFGPYCNAEIKNGGLPDWIVNNKNLVTRSNDPLYLEYSRRWYQAVY
DQVKGLLWKDGGPIMALQLENEYVRPGMIVSHLITLKKMAVEIGFDVPIYSMTHWMDSEY
PKGEIIPYAGFYIEAPWTASGKNEIPTSNFEFFTYNRLSDNIGTDIIKIEGEVESLSGKN
NDSPFFTCEIGVGTTAFYQRRAVVPKEMAGENINLRLGCGANMMGYYMYAGGTNPVGKIS
TYQSSGPRVSYDYQAPIREFGTLGTVMQETKKYNYFMNDFGTALAPAVAYLPTNNQDRDN
LQWAIRLNKNSGYLFCSNYLYKHSRKDYKNVQFTVKLKDETIRMPRKKVTIKNGTYFLWP
FNQTFNEVLLKYATVQPICSLKEGNTDTYFFFEDDFISSEYLIADKGIQTIEVKNGSSKK
EKNGYFIDQLTPGKECIIEITKENGSKVRFITLTEEESDHIWKGKIKGKEFVAITSSSLI
YDNNRITLIDEQPVTAIWKYKNGHFEQQMFQVPAHNHLQVQFRPISPMEKSLWIRPATGN
IAKRRFTLNTFSQVERAYLRYVSSDLTPCLINGKEIKATHKGDYLYANVTNMIQNGDNTV
EFTLANNNEIVAEIEVLLKNGKRILWNTDATWLSADNKPILTTAGMQKPTTFAPEEHVGL
YEVKVPAAACNDEETRMYISYKGDIANAYLNGDLVGDSYFDGTEWILSLSRLRESIDTNP
MTIRIDGLRSADVPIYFEKNVDPAECVVPTISDIQVKQEYRFKLDK

Enzyme Prediction     

No EC number prediction in MGYG000002033_02192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	59	392	3.4e-82	0.9706840390879479

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	2.23e-53	67	394	14	309	Glycosyl hydrolases family 35.
PLN03059	PLN03059	7.68e-28	65	487	47	442	beta-galactosidase; Provisional
COG1874	GanA	1.34e-12	67	203	20	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	1.82e-06	71	203	2	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ34970.1	0.0	1	885	1	884
QCQ48325.1	0.0	1	885	1	884
QCQ52773.1	0.0	1	885	1	884
CBW24573.1	0.0	1	883	1	882
AKA53703.1	0.0	1	883	1	882

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KDV_A	2.59e-32	59	393	29	331	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	7.03e-31	59	393	22	324	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	8.03e-31	59	393	46	348	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	1.88e-30	59	393	46	348	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
4E8C_A	1.07e-27	47	231	5	185	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58D55	2.28e-34	59	393	44	346	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q9TRY9	7.92e-33	51	393	39	348	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
Q60HF6	1.49e-31	59	393	45	347	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
P23780	1.60e-31	59	393	46	348	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q93Z24	3.78e-31	67	567	82	597	Beta-galactosidase 17 OS=Arabidopsis thaliana OX=3702 GN=BGAL17 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000673	0.997944	0.000682	0.000214	0.000229	0.000207

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002033_02192.