CAZyme Information: MGYG000002038_00577

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000002038_00577
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731	MGYG000002038_21|CGC1	81328.95	5.4363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002038	2369275	MAG	China	Asia

• Gene Location: Start: 10653; End: 12848 Strand: -

Full Sequence      

MSLQTVQWIVCPETAESPIIRKQFTLTRPIRGEIAVTGLGFFTLKLNGHPVTDQVHIPAP
TDYEPRDMSRWCYPLFDQPTHRIFYLRLDLTTFLANGANTLELQLGPGWYRQRERVAEGH
MSFGARLKAAFELSVESADGSVARICSDGTEKWVPSDITYSNLFIGEVHDARLRTVPHEP
EPVIAVAPPEAELTEQTCPPDRVVRQISPKLLYTDGSRRIYDAGENLSGWVAVRADGKPG
DEIRLTFAEALKDDDLDPLSTGADYKGTTRMQLQEDRFICSGQPETFRPQFVWHGFRYFD
VTGPASDLTVEEVHTDLAVTSAFECGNPVLNWLFDADIRTELSNIHGCVPSDCPHRERLG
YTGDGQITAPTVMTLLDAQGMYRKWIRDILDCQDKLTGHVQHTAPLMGGGGGPGGWGCAM
VIVPDEYDRRYDDRVLLAECYPYMQRWVGYLKSHSEHGLVQSEEAGGWCLGEWASLHPVQ
IPAPYVNSCYFLDTLHRMTAIADRLGYPSDARMYRTYAKVVRDALIRTYRDPATGSFCGG
VQAADAFAVWAGLDDDGRAMQNLVQRYQTVHYFDTGFLGTEILIDVLMRHGACDTAYALM
TSPEIGSYAHMMHHGLTTIGEYWQLICSLNHPMYGAPTRHLLDGLLGIRQAADSYGYRDL
RIAPQIPAALDHASGAMTLPCGRVSVRWVQSADAVTVDVTLPADKTAELSLYGQTVALHG
GENHHVISKPQ

Enzyme Prediction     

No EC number prediction in MGYG000002038_00577.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	217	711	1.4e-123	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.77e-69	320	637	3	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.17e-28	28	205	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.48e-19	220	314	9	97	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	8.37e-09	647	725	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	4.73e-185	1	686	1	683
BCJ98018.1	4.81e-134	8	711	127	858
QOY86540.1	4.21e-133	14	725	148	856
QUT50058.1	5.65e-116	14	730	158	877
QBE96295.1	3.52e-103	7	723	125	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.14e-67	10	709	295	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.41e-51	21	688	135	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.65e-67	10	709	295	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	8.45e-61	21	711	188	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.35e-53	20	711	177	878	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.52e-52	20	708	173	875	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002038_00577.