CAZyme Information: MGYG000002040_00901

Basic Information

• Species: Faecalibacterium sp900758465
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium sp900758465
• CAZyme ID: MGYG000002040_00901
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000002040_6|CGC1	66068.32	6.3298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002040	2277187	MAG	China	Asia

• Gene Location: Start: 33067; End: 34836 Strand: +

Full Sequence      

MHPLPEYPRPSLRRDSYLNLNGLWDYAITRSPEFPARWDGSILVPYSPEARASGVSRTLQ
PGQWLHYHRAFTPPAGEGGRVLLHFGAVDYACAVEVNGRLAGGHRGGYWPFTLDITDLLR
PQGHNTLWVAVQDPTGAGTQARGKQTLKPGGMFYPAQSGIWQTVWLERVPENYIESLTVT
PDYDARTVTVRVHTTKPGGAVNVWAAVRAGGVTIAEDWGSDEADQDGEVTLNISEEHFFP
WSPDSPFLYDLTVGTTQGEEEGFDTVHSYFALRKWECREDGRGVKRFFLNGKPILLNGLL
DQGYWPEGLYTPPSDGAVEHELHTVRELGFNLLRKHAKIEPERWYYHCDKLGIIVWQDMV
NGGGAYPMWYVTYLTNALQPLLRYAPDGKLLWGLLGRGSAHSREEYSRELADTVAALGQH
PSIGCWVPFNEGWGQFDAEKATKALRALDPTRLVDEASGWFDRGGGDVHSIHNYFYPLRI
RPKARTVALSEYGGIAWPMPGHEPPRKTYGYGTVRSRAELTGRYRDLQLKTILPQLRKGL
SALVYTQLTDVEDEVNGLFTYDRRAIKPEAAAIRAVNEALEAEFEKVVS

Enzyme Prediction     

No EC number prediction in MGYG000002040_00901.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	14	477	1.8e-94	0.5026595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.31e-26	7	454	3	445	beta-D-glucuronidase; Provisional
COG3250	LacZ	1.65e-26	20	454	15	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.56e-14	17	454	41	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	5.34e-08	20	131	4	133	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	8.65e-07	173	273	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA81870.1	0.0	1	588	1	588
CBK98667.1	0.0	1	588	1	588
ATL90007.1	0.0	2	588	4	590
QIA41822.1	0.0	2	588	4	590
ATO99791.1	0.0	2	588	4	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	5.64e-138	4	577	26	579	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	1.59e-25	8	458	12	454	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	4.10e-25	8	458	37	479	Thestructure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6U7I_A	1.37e-20	18	431	13	412	Faecalibacteriumprausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_B Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_C Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_D Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii]
4JKM_A	1.22e-17	64	452	68	441	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	1.33e-19	77	503	71	465	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	2.24e-17	83	394	124	427	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q02603	2.35e-13	77	454	143	489	Beta-galactosidase large subunit OS=Leuconostoc lactis OX=1246 GN=lacL PE=1 SV=1
A1A3T0	6.11e-11	14	476	98	528	Beta-galactosidase BgaC OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=bgaC PE=1 SV=1
P23989	2.40e-10	80	492	138	512	Beta-galactosidase OS=Streptococcus thermophilus OX=1308 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002040_00901.