CAZyme Information: MGYG000002042_00069

Basic Information

• Species: CAG-110 sp900762935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900762935
• CAZyme ID: MGYG000002042_00069
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		69245.76	5.6248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002042	2052895	MAG	China	Asia

• Gene Location: Start: 5270; End: 7126 Strand: -

Full Sequence      

MERYFGLHFDFHAGNEAHIGSRTDPADIAWYLEQAQPDFVQCDCKGHPGNASYPTSLGNA
AAHLDADNLKIWSDTVHGRGLPLFVHYSGVYDAAYTAAHPDQAAVDENGQRTDAVSVFGD
YADRLLIPQLEEVMDRYGIDGVWIDGDCWSVRRDDSARARPHLRPGLSQEEHNRIMREGY
LAYVRHYTDALHAYRPDFKVISNWLYSSQVPEKPEIGVDFLSGDFTPNDSAHAARFEARC
MALQGKPWDLMAWGFSKDRAHQDLNCDKPAAQLCQEAAVVLSLGGGFQVYISQNADGSAP
RLRSTRLREIHDFVAPRRALNFQKPPLAQIGLYYSAQSRYHETAADPSAFNPPHVSDSLI
GTIHCLLDGQYTVNCVLEHQRDTLGRYDVVVVPAWTAIPQTHRQGLLTYARNGGKLVVLG
PETCRAFGADMGLIFGETETGAKALCTEDGLFCRFYTDFLDLQTGEGALYRNKDLRDGQL
PAYRTEVLERGSVTFLPFDLGTAYLPNRSFFLTEYLRRILGTLCTPWAELNRSDIDITFQ
QGDGETVVNLINLRQDRHSLEAPVFRTVPPAENVELRLHRVCREVTMPLGETFTWEVSGG
DTVIHLPKLEIHSVLLLK

Enzyme Prediction     

No EC number prediction in MGYG000002042_00069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	24	145	1e-18	0.9847328244274809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	4.94e-04	67	315	128	331	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	6.98e-04	67	147	131	202	Alpha-L-fucosidase.
cd03143	A4_beta-galactosidase_middle_domain	0.005	379	423	46	89	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ97761.1	3.59e-130	2	617	5	641
AXE19470.1	2.34e-115	2	618	26	661
AYQ34964.1	9.18e-115	2	618	26	661
QJW90012.1	2.85e-102	2	616	37	678
QEC53053.1	6.13e-102	2	615	31	667

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002042_00069.