CAZyme Information: MGYG000002042_00265

Basic Information

• Species: CAG-110 sp900762935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900762935
• CAZyme ID: MGYG000002042_00265
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581	MGYG000002042_6|CGC1	66746.88	5.0389

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002042	2052895	MAG	China	Asia

• Gene Location: Start: 12844; End: 14589 Strand: -

Full Sequence      

MTQNIDRFTVTMAPGQNLALSAVETRDGITFYRFHLTWTEENAARDDAFTVSWTHPIRNI
LYKWDASLQLCRNIYRAWDDNYFSMISSHAPLTCFFDGSGNNACCWSLDECRKYVHLYSI
LDDRTCLLTPRFTLPVRQYTGRTSADLTLRIDTRPVTLRQAVADTADWWANDCGMTPAYV
PAAAKDPAYSFWYSFHQDIHDEDVVAECRRAKALGFDVCIVDDGWQTEDSSGGYAYTGDW
EPAPGKFPDMAAHVAKVHDIGMKYILWYSVPFVGYYSKHYEHFRSMMLYTQDNLKAGVLD
PRYQEVRDFLAGTYEKALREWNLDGFKLDFIDSWRDGPDNAPYNEKMDIPALQDAVDVCM
AEIMDRLKAIKPDILLEFREAYIGPHMKRFGNMFRVGDCPGDFIKNRVTSLDLRMLMGDQ
AVHSDMLMFTPEERPENDALQIISVMFSVMQYSARLDRITPETARMSKFWLDFLKAHKSL
LQSRNLRTYEPHLLYTWAQVTEGRECAAAVYAIDKCIRPDPVDTLYLANGCACDRMMLEL
EGTYRVRIFNCYGDETAAFTKAFDGISTLPVPMGGLTILEK

Enzyme Prediction     

No EC number prediction in MGYG000002042_00265.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	191	509	6.1e-32	0.4752906976744186

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	5.53e-59	189	476	6	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	8.22e-13	192	377	48	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	1.22e-10	185	330	1	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd14792	GH27	3.51e-10	192	434	8	229	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	5.53e-07	192	330	299	451	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31288.1	4.92e-144	18	581	15	585
QWH41655.1	1.43e-143	27	581	26	586
QWI48925.1	1.43e-143	27	581	26	586
QWG32884.1	5.72e-143	27	581	26	586
QWH11404.1	5.72e-143	27	581	26	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JHP_A	1.13e-07	185	377	359	557	Crystalstructure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_B Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_C Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_D Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila']
4FNR_A	3.98e-06	192	329	336	478	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002042_00265.