CAZyme Information: MGYG000002044_00090

Basic Information

• Species: Fructilactobacillus sanfranciscensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Fructilactobacillus; Fructilactobacillus sanfranciscensis
• CAZyme ID: MGYG000002044_00090
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
217		24942.81	10.4231

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002044	1209423	MAG	China	Asia

• Gene Location: Start: 26410; End: 27063 Strand: +

Full Sequence      

MWVFNLAKKRRRKRKRTRKTKKNNVSGYGLIVLIVIGMFLVVGIMKFVKSPTFIYYNQPN
ISQQDKKFVNKVLPEAVVVQKKYRILTSITLAQAILESNWGQSELAAKYHNLFGVKAGAN
QPGVNLTTTEYRDGKPETVTGRFRVYDSWKQSIDDHAMLLAHGTDWNALQYKEVVQADNY
KDSAKGLSMDGYATDPAYAQKIIQIIEKYHLNKYDRN

Enzyme Prediction     

No EC number prediction in MGYG000002044_00090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	74	211	6.6e-39	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.29e-62	60	216	40	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	1.52e-38	62	215	317	472	amidase domain-containing protein.
TIGR02541	flagell_FlgJ	9.17e-37	66	208	149	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK05684	flgJ	1.12e-36	62	208	151	296	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	8.01e-36	60	215	3	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN99482.1	5.02e-132	32	217	2	187
QFX94553.1	6.84e-130	32	217	2	187
ANZ58527.1	2.64e-93	32	217	2	187
ANZ59836.1	2.64e-93	32	217	2	187
QFX92430.1	1.83e-80	56	216	22	182

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	2.71e-28	68	215	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	6.23e-23	62	215	57	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.99e-21	68	206	4	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.47e-21	68	206	5	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	1.88e-20	68	206	5	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.08e-45	64	215	47	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q2G222	1.11e-21	62	215	317	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
A2RHZ5	2.16e-20	68	215	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	5.55e-20	62	215	59	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	1.05e-19	68	215	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000011	0.000039	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
23	45