CAZyme Information: MGYG000002044_01123

Basic Information

• Species: Fructilactobacillus sanfranciscensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Fructilactobacillus; Fructilactobacillus sanfranciscensis
• CAZyme ID: MGYG000002044_01123
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	MGYG000002044_69|CGC1	30610.76	9.9703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002044	1209423	MAG	China	Asia

• Gene Location: Start: 2139; End: 2936 Strand: +

Full Sequence      

MSKLSRKAYQQQQRVSRRQKWMIIMGLLLCLCVIGLLIFQHIAGQRQQQKQFLTKHPVRG
LIINQDDSYVDFTQVNQDGMKYAYLRASQGASFTDDNFNDNYSRSIGSGLKIGVYHQFGF
GSSIKGQEKNFVESVGNNIGDLPIEIRISYYGNYNSHNVKPKKLFNDVNEMTAYLYHKYH
RPVLLKTNQRNYEILKKIPHAQFAITGKQHAKNSKFIGLSNANQIYDNGKISEYEMSAFN
GNKVKWEEYLKQLKSDDLEKSNAND

Enzyme Prediction     

No EC number prediction in MGYG000002044_01123.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	67	193	5e-19	0.6892655367231638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06419	GH25_muramidase_2	1.20e-40	53	239	3	190	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	2.70e-22	59	189	1	127	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06413	GH25_muramidase_1	5.49e-18	57	184	2	129	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06525	GH25_Lyc-like	4.12e-14	59	148	1	86	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	5.51e-10	55	255	60	269	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFX94256.1	3.21e-186	1	265	10	274
AEN99459.1	2.88e-129	62	245	1	184
ANZ57969.1	1.58e-117	1	265	1	265
ANZ59239.1	1.58e-117	1	265	1	265
QFX92440.1	1.50e-61	1	265	1	270

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	1.39e-14	44	249	2	216	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	1.31e-06	58	116	5	63	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	4.78e-06	58	149	20	110	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	7.70e-06	58	149	20	110	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	5.09e-07	58	149	9	99	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	2.11e-06	58	116	1	59	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999971	0.000031	0.000000	0.000000	0.000000	0.000021

TMHMM  Annotations     

start	end
21	43