CAZyme Information: MGYG000002049_00080

Basic Information

• Species: CAG-485 sp900556595
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900556595
• CAZyme ID: MGYG000002049_00080
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		42879.18	9.755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002049	1913681	MAG	China	Asia

• Gene Location: Start: 46779; End: 47918 Strand: +

Full Sequence      

MKYVIIAGEASGDLHASQLIKYLKEFDEEADIRFFGGDLMAREARCSPDLHYDQMNVMGF
SEVFRKLPALIRNLKQAKALLLDFHPDALVLVDYPGFNLTLAPYAKKLGIRVHYFISPKV
WAWKEYRVKKIKRCVDKMYSILPFEVPFYKKHGYEVKYVGNPSVQEVAHSMGHLPPKKHF
MERQGLKDERPIIALLPGSRKREIRNNLPLMLEAAKRFGDFQYVVGAAPAVPEKYYREVA
QDPGLKVVFGCTPTLLKYSQAAVVTSGTATLETALIGTPQVVVYRANGMAISYKIMEKLL
KVKYVSLPNLIVGNAVVPELLVHKCTVDSIARELAPLLQPSPRRDWQISGYKNMQRRLGN
YVAAEYAAELIVEDVKSSN

Enzyme Prediction     

No EC number prediction in MGYG000002049_00080.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	358	1e-114	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	6.40e-119	1	373	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.19e-115	1	373	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.60e-81	5	371	3	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.94e-70	5	373	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.78e-58	1	330	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	5.68e-137	1	378	1	377
QQR08529.1	1.11e-130	1	371	1	370
ASB37800.1	1.11e-130	1	371	1	370
ANU64105.1	1.11e-130	1	371	1	370
BCI64292.1	3.61e-114	1	375	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.32e-43	5	373	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.31e-43	5	373	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.68e-74	2	373	6	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	3.39e-67	4	379	7	382	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	5.93e-65	2	373	8	378	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	2.48e-63	2	378	8	383	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	2.79e-62	2	373	8	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002049_00080.