CAZyme Information: MGYG000002051_00212

Basic Information

• Species: Prevotella sp900546345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546345
• CAZyme ID: MGYG000002051_00212
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499	MGYG000002051_2|CGC1	55611.95	4.7325

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002051	3257941	MAG	China	Asia

• Gene Location: Start: 32981; End: 34480 Strand: -

Full Sequence      

MKYKNSLSILFLLLVSLLVGACSSDDDVQKASTLSVTQNGSVVDAITFQLSEGNTMLGVS
TDADWTVSVPDADTTWLKITPHEGYGWAVNDTAATNTKAYVKVSVTSNDGAQRSSQLTFT
AGALTKVVTVTQKGVELDPGDTFQSSYDFVKSIKFGYNLGNTLDSDPDVNTSSWIDFTKG
TSAWETAWGQPVTTQAIIDAIIAKGFNVIRIPVSWHAHMDANDRVDAAWMARVKEVVDYV
VKAHPDCYCILNVQHDTGAKEASRKDDAGWLYANLDDYPSITKRYQKLWKQIATEFKDYD
DHLLFEAFNEILNKDKSWASTPSATDLKAVNKLEQDFVNTVRATGGNNAYRNLVVNPYAA
SSTQANLDAFTVPQDVHPNHIIVSIHSYDPYWFCNDTSNKDDEKYYIKVFDTSCQTEIDN
VFTRISTRCNAMGVPYFFGEFGAIGAHPEMAERVKYAEYMRKKFAEYGTSGLWWSNLYNR
STGVWYEEDLVNALFGTAN

Enzyme Prediction     

EC	3.2.1.151	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	185	476	3e-88	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.90e-45	185	476	16	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.76e-11	149	443	47	323	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	3.79e-11	33	133	1	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	8.09e-05	66	133	1	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPB75690.1	1.96e-169	22	494	13	497
QRX63738.1	6.13e-93	1	498	1	479
AEX97596.1	2.79e-81	141	498	30	379
BCS86234.1	9.12e-81	88	499	362	775
ACA61160.1	1.75e-76	150	494	156	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D9N_A	1.48e-74	144	494	11	347	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9N_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 member from Prevotella bryantii B14, in complex with the xyloglucan heptasaccharide XXXG [Prevotella bryantii],5D9P_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii],5D9P_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, in complex with an inhibitory N-bromoacetylglycosylamine derivative of XXXG [Prevotella bryantii]
5D9M_A	1.15e-73	144	494	11	347	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9M_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with the xyloglucan tetradecasaccharide XXXGXXXG [Prevotella bryantii],5D9O_A Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii],5D9O_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14, E280A mutant in complex with cellotetraose [Prevotella bryantii]
6D2W_A	1.05e-70	128	494	418	770	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3VDH_A	1.49e-70	144	457	11	303	Crystalstructure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii],3VDH_B Crystal structure of PbGH5A, a glycoside hydrolase family 5 enzyme from Prevotella bryantii B14 [Prevotella bryantii]
6WQP_A	7.74e-62	153	494	23	352	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54937	1.62e-59	142	494	35	374	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P17901	5.58e-53	149	483	50	374	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P10477	1.48e-52	145	494	56	381	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
Q12647	2.05e-49	145	494	24	359	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P23660	2.55e-49	145	498	26	363	Endoglucanase A OS=Ruminococcus albus OX=1264 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002051_00212.