CAZyme Information: MGYG000002051_00956

Basic Information

• Species: Prevotella sp900546345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546345
• CAZyme ID: MGYG000002051_00956
• CAZy Family: CBM4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804	MGYG000002051_9|CGC2	88413.78	4.7078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002051	3257941	MAG	China	Asia

• Gene Location: Start: 61214; End: 63628 Strand: +

Full Sequence      

MKLNHIILPLAALLLTTACDDQIMKWGTPEGHDEVTATDIPLAVKEVLANYAPIKDYAKQ
YTPKMVVGLGMGANLYAENYKDVYQNLANDNFQMFTPGNAMKMDAVVGNSGKLTFTNIDA
MLDAMPSDVRLYGHNFIWYQQQSQTYLKSLIAPTMVIKTDGDIASVLANGSFDTDLSPWS
GWGNSSTREWVKAGEDGSGCVHLVNPTDANPWSAQMVQNFSSPLEPGKTYTLRFKARASI
AAGSLQFVVQNNKTYKGEGYVTTAVGTKWQTYELTITTKADDLNQFCVNFGKVAAEYWID
DIQFGEKKEDPMTNILAGDATDFEGGTTGGWGSWGSNKESGTVESGKGKDGSYGLVLKTK
KDGNYWEAQCAYTFDTYLDASKKYLIQFWAKSNTSAGKLQFQYQNGSTYGSQGAYTEFNV
GTDWTLCEASFTPAYDDVNRILINFGKVDGTYQIDNIKFGVAKDQGSAAGAKEFILARSS
RPRRATSITYKVKTAEEKRTALLGAMEAWIKGMADHLAEKKVVPYGYDVVNEPITDGTAL
VRGVDEGAFGGSTTDDDGNTTYDSAPTESTTEGLNLNWGDGRFYWGYYVKDYAIKAFQYA
RQYLPAETKLFVNDYNLEVSPAKLAALVKFVKGIDEANGSPIVDGIGTQVHFDLHAATDN
TVTNDSIIKGLRTKVDEMFRSLAASGKLVRVTELDVSLGTSSPSAAQYKCQSDCYKMIFE
SYKANIPEAQQSGITIWSLSDNEAEHEYWLKGDVPNLFDASYLRKWAYKGVCDGIAGEDL
GLKYGGEDYKAYYEKQNVSSTVNE

Enzyme Prediction     

No EC number prediction in MGYG000002051_00956.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	498	773	2.1e-40	0.6798679867986799
CBM4	166	290	4.3e-19	0.9761904761904762

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	3.51e-34	498	771	54	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	2.30e-28	492	773	90	310	Glycosyl hydrolase family 10.
COG3693	XynA	1.21e-22	501	771	122	337	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam02018	CBM_4_9	5.10e-11	164	282	1	121	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.
pfam00331	Glyco_hydro_10	1.16e-08	54	141	1	85	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92890.1	3.96e-210	1	796	1	765
ALJ61540.1	7.91e-210	1	796	1	765
EDV05054.1	1.16e-197	1	804	1	782
QDO69424.1	2.31e-197	1	804	1	782
QCP72441.1	4.08e-157	1	798	1	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F8Q_A	2.91e-17	493	773	108	353	Analkali thermostable F/10 xylanase from alkalophilic Bacillus sp. NG-27 [Bacillus sp. NG-27],2F8Q_B An alkali thermostable F/10 xylanase from alkalophilic Bacillus sp. NG-27 [Bacillus sp. NG-27]
2FGL_A	2.95e-17	493	773	109	354	Analkali thermostable F/10 xylanase from alkalophilic Bacillus sp. NG-27 [Bacillus sp. NG-27],2FGL_B An alkali thermostable F/10 xylanase from alkalophilic Bacillus sp. NG-27 [Bacillus sp. NG-27]
5EB8_A	2.98e-17	493	773	110	355	Crystalstructure of aromatic mutant (F4W) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27],5EB8_B Crystal structure of aromatic mutant (F4W) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27]
4QCE_A	2.98e-17	493	773	110	355	Crystalstructure of recombinant alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27],4QCE_B Crystal structure of recombinant alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27]
4QDM_A	2.98e-17	493	773	110	355	Crystalstructure of N-terminal mutant (V1L) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27],4QDM_B Crystal structure of N-terminal mutant (V1L) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36917	4.41e-15	591	773	515	674	Endo-1,4-beta-xylanase A OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynA PE=1 SV=1
P38535	7.41e-15	591	773	367	526	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P29126	7.30e-13	525	771	767	949	Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens OX=1265 GN=xynA PE=3 SV=1
Q2PGV8	1.08e-12	596	775	185	355	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1
P07528	2.45e-12	591	773	215	396	Endo-1,4-beta-xylanase A OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002051_00956.