CAZyme Information: MGYG000002051_02384

Basic Information

• Species: Prevotella sp900546345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546345
• CAZyme ID: MGYG000002051_02384
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837		95169.48	8.1142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002051	3257941	MAG	China	Asia

• Gene Location: Start: 20609; End: 23122 Strand: -

Full Sequence      

MKKILLFLLALFPLWVSATDFEIATPGHRPATIVVDTADWKGVRLAAHDLSNDVRRVCGQ
AAPLTFWSAGLMPAQGSIVAGTLGKSRLIDKMVKAHKIDVRRLRGQWESYLIDVVDGNLV
IIGSDKRGTIFGIYELSREMGVSPWYWWADVPVKHQDHMIYSAGRQYQPSPRVKYRGIFL
NDEAPCLTTWVKNTYGTNYGGHQFYDRIFELLLRLKANFMWPAMWGWAFYADDPLNSKTA
DDRGIIIGTSHHEPMCRSQKEWHNHSDNPNVEPQDRASRIAAGGKWDYTTNQAALDSFWA
GGVRRNKATEDIVTIGMRGDGDMAMSESTNIQLMKKIIRNQRRIIEKERGKKASEVPQVW
ALYKEVMDYYDAGLRVPDDVTLLLCDDNWGDVRRVPKAKERNRKGGWGLYYHVDYVGAPR
NSKWINVTPTQNMWEQLSLAAENGIDRLWILNVGDLKPMEYPIQLFIDMAWNPTAFTADN
ILDHTRQFCAAAFGQDQAQEAARILNLQGKYAGRCTAEMLDASTYSLSDGEWEKVVNDYA
ALERDALRQYATLPENCRDAYQELILFPVQAMANLYDMYYAQAMNHQLYHQGSPEANTWA
ERCRQDFRRDSLLCAAYNHDIAGGKWNGMMIQKHIGYTTWNDNFPHDMLPKLYAVEPRSN
GWIIDAAHGKVVLEAERYYRKLDAEEARWIHIPFMGPSLGAMTLRPTTAPVKGAQLEYRF
RGLPATDSVTVCITTKSTLDFLNQGGLRYQVSLDGCGKTVNFNANLNEKPENIYSVYYPT
VARRIVTMTLRLPLSEKSDGIHQLVFAPLDPGVVLEKITVVTGKRNQTIISTKTKNK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	27	818	1e-269	0.9870875179340028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	170	519	2	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.51e-26	667	823	5	161	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	7.25e-04	30	136	21	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG34758.1	0.0	28	823	6	786
BCS85271.1	0.0	15	830	25	823
AGB29053.1	0.0	17	823	36	819
ALJ48348.1	0.0	17	823	19	826
EDO10816.1	0.0	17	823	30	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	17	823	30	837	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	2.03e-314	30	823	25	822	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.48e-311	30	823	24	821	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	8.43e-186	31	660	23	638	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	1.33e-105	42	643	31	648	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000216	0.999156	0.000163	0.000152	0.000138	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002051_02384.