CAZyme Information: MGYG000002051_02437

Basic Information

• Species: Prevotella sp900546345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900546345
• CAZyme ID: MGYG000002051_02437
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	MGYG000002051_44|CGC1	51483.73	9.577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002051	3257941	MAG	China	Asia

• Gene Location: Start: 17116; End: 18486 Strand: -

Full Sequence      

MIQRFIGRLLRSRLLMVCAIFAVAVSAFAQETSNHLYKVKKSDTLYGIAHYHGITVDQLI
NANPEMKLPGYQLHKGDRLYIPSPGNTAATAKNPSTGKDSLGAKQSKILRVGIALPLHNV
DGDGRRMVEYYRGVLLACDSLKRAGYSIDIHSWNLDATADPALVTRDPAAAQCNIIFGPL
YSTQVHALAEFCKARDIKLVIPFSISGDDVTSYSQIFQIWQSDDKLNNDAIEAFLKRYKD
ARVVLIDCNDKTSKKGNFTFGLRNRLSSRGQEYRVTNLNSSLETFAKAFDPNRLNVVVLN
TGRSPELNQSIAKLRALRAQQHGLRMALFGYNEWLMYAPGNVDTFCSFDTCVPTYYYYND
ADPRTKRLEADYQKWFHEKPMYAYPRFFLTGYDHAQFFLRGMAKYGKSFTGIAGQSAYRA
YQTPLVFKQVGDKGMQNDNFQLIHFATGGRIESLTY

Enzyme Prediction     

No EC number prediction in MGYG000002051_02437.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	2.89e-09	37	81	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	6.00e-08	37	82	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	1.04e-06	37	81	2	44	Lysin motif.
PRK10783	mltD	2.18e-04	10	79	374	444	membrane-bound lytic murein transglycosylase D; Provisional
pfam13458	Peripla_BP_6	0.001	130	444	21	330	Periplasmic binding protein. This family includes a diverse range of periplasmic binding proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB46898.1	1.05e-158	12	456	6	451
ALO48876.1	1.01e-150	13	456	6	448
EFC70285.1	5.61e-144	28	456	21	454
QYR10688.1	1.50e-132	25	456	18	450
QUB86322.1	9.31e-129	37	456	31	462

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000284	0.998984	0.000209	0.000168	0.000162	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002051_02437.