CAZyme Information: MGYG000002053_00133

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae
• CAZyme ID: MGYG000002053_00133
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534	MGYG000002053_21|CGC1	60242.77	9.0282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002053	1441273	MAG	China	Asia

• Gene Location: Start: 2637; End: 4241 Strand: +

Full Sequence      

MIRSIRFPVILLLLFIGSLVLFLWGAQQMPVTDPVESNYALTAKEMVLSGDWISPQIYGT
YWYDKPALVYWLLSTSYTVFGFTNFASRLPAALCGAFSVVAMAWYVYRIVNVKSIAVWSA
IFLATSIEFWVVSHAIVTDSMLLLFTIPTMFAAYIGITEKSWLHMTIAYAAAALACLAKG
PVGLVLPGMILFLWCLTTKSARNVFRLFTPSGILVFLLLAAPWYYAMYAIHGQAFIDGFI
GLHNVTRAVAAEHPEDNHFYYYLLILPVALLPWTGLSFYTMVKKWKDRTPLYDFLMIWCW
GTILFYTLVATKYVTYTYIAVVPAILLAALAIPYLLENGARKAQLTLIAPYILTMAALIA
GTFYVDGNYMSFYVIAAYSSILLLVQWKKQQASSMLLLSTASMAVSLLCIILGGLTNFVA
FRSTIDMADYFKSLPGEHYFYDNYQPSYTFYTGDVAVRLHDEGRGSGKDRDARWAKKYVM
PTATTKDFLAHAKGQPISVFVPRGDRKDFENWAGRSHFKEDKVFASGTIYQWEK

Enzyme Prediction     

No EC number prediction in MGYG000002053_00133.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	11	411	2e-91	0.7685185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	8.64e-41	10	416	9	422	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	9.15e-26	3	341	2	343	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	3.40e-13	64	225	1	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	5.14e-07	1	231	2	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24579.1	1.15e-179	14	530	32	548
AOH39318.1	6.33e-166	10	532	11	536
AXB83023.1	8.55e-132	10	509	6	513
BBU37212.1	2.01e-121	15	530	11	534
QQB17174.1	5.17e-119	15	530	11	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.88e-18	18	276	41	302	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.60e-26	12	316	6	305	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
Q1CIH9	2.61e-24	33	329	31	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=arnT PE=3 SV=1
B2K5L1	2.61e-24	33	329	31	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=arnT PE=3 SV=1
Q1C744	2.61e-24	33	329	31	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=arnT PE=3 SV=1
A4TIM6	2.61e-24	33	329	31	331	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis (strain Pestoides F) OX=386656 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.979714	0.016552	0.003177	0.000053	0.000034	0.000489

TMHMM  Annotations     

start	end
7	26
67	86
93	110
114	133
140	157
172	194
207	229
259	278
291	310
314	336
343	365
369	387
394	416