CAZyme Information: MGYG000002056_01098

Basic Information

• Species: CAG-115 sp000432175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; CAG-115; CAG-115 sp000432175
• CAZyme ID: MGYG000002056_01098
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		44608.56	5.1822

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002056	2653439	MAG	China	Asia

• Gene Location: Start: 20163; End: 21305 Strand: +

Full Sequence      

MTNYRTDFDALEKKLSAMLVDPDRLVTPDPTPNTRRLWEYLKSCYGRKFISGQQYLWEDE
KEDLVYWNATGKIPAIRGYDFMGISGLARGYDQLGRALDWARRTGGILTMCWHWNAPDDM
EDIAKCCSFYYKTTNYDHKTGFDIVRAMQEGTPEHDFVIYEIDLVAGALKMFEQADVPVL
WRPLHEAAGNWFWWGNRAEAGKQDPESIAAYKKLWYTIFDRFMNLHKLRNLIWVWNGQAP
FMAVSPNTFDIAGEDIYDEVPNHSSQLERFRGVTSYTHGKMITLSECGSIPEPDEMLNDG
ATWLWWLPWWGSFVYDTDDNWHAVLDENGMPRPNPKYMDEAFMKRIFTDPRVVTLEDLPW
YDKEKKPLPFALHQRLRNKK

Enzyme Prediction     

EC	3.2.1.78	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	26	354	2.2e-80	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.04e-41	26	311	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	9.80e-08	164	261	167	260	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK96404.1	1.47e-156	25	376	11	356
CBL34792.1	2.96e-156	25	376	11	356
CBK96003.1	1.40e-94	4	369	70	432
CBL34396.1	3.93e-94	4	369	70	432
AIQ56350.1	6.57e-78	11	359	2	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	6.64e-55	7	364	27	362	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	1.01e-48	26	359	35	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HPF_A	2.62e-48	26	320	7	290	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	2.62e-46	25	327	145	434	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6D2X_A	7.26e-40	35	328	14	326	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	2.10e-49	22	359	143	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	2.26e-49	31	355	34	330	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55297	4.95e-48	25	362	158	465	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	6.66e-48	25	362	156	463	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
G2Q4H7	5.92e-47	25	362	174	481	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002056_01098.