CAZyme Information: MGYG000002059_00312

Basic Information

• Species: Gemmiger sp900554145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900554145
• CAZyme ID: MGYG000002059_00312
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000002059_13|CGC1	56001.97	4.9004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002059	2037611	MAG	China	Asia

• Gene Location: Start: 11454; End: 12905 Strand: +

Full Sequence      

MEKMSKYNGLPKDFIWGGALAANQMEGAWKEGGKGWCLADINRSQYDIPPEKRYNQEIDT
AYIKRAMEEDDKYYPKRHGIDFYHTYPEDIKLLAGTGMNGLRTSINWARIFPNGDDAEPC
EEGLKYYDNLIDCMIANGLDPMITISHYEMPLNLALKYNGWASRDLVDFFVKYCETLFKR
YKGKVHKWIIVNQINLIVHESFNHLGIASDKVDNLLEAKYQGVHNEMVACAKATKIAHEI
DPDNQIGMMFCSNLTYPISHRPEDVLWNMKHNQMEYLYGDIMVRGYYPGYALRYYDEHNI
HIEFYPGDEEALKEGTVDFVSLSYYYTRLSGEEPYLHTELGQVPNPDIPASDWGWSIDPV
GLRIALNEYWDRYQKPLYITENGLGAYDKVEADGSIHDTYRIDYLRAHIEQMKEAVKDGV
DLRGYYPWGPIDIISCSSSEIEKRYGFIYVDYDNNFNGTGKRSKKDSYYWYQKVTASNGE
DLG

Enzyme Prediction     

No EC number prediction in MGYG000002059_00312.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	479	1.4e-134	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	10	481	4	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	0.0	9	482	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	5.87e-178	11	483	5	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	1.23e-169	10	482	6	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.01e-163	10	482	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZO96657.1	2.17e-253	4	482	1	477
QQL13776.1	3.39e-239	8	482	8	480
ADL02654.1	1.28e-238	1	482	1	477
QRV19127.1	1.28e-238	1	482	1	477
BBB47611.1	1.48e-237	4	482	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.16e-165	11	482	9	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.47e-153	10	482	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.05e-148	10	482	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.97e-148	10	482	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	1.21e-146	11	482	21	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	5.96e-168	11	482	9	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	2.83e-157	11	482	5	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	1.48e-153	11	482	5	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
Q46829	8.05e-153	10	482	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.14e-152	10	482	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002059_00312.