CAZyme Information: MGYG000002059_00464

Basic Information

• Species: Gemmiger sp900554145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900554145
• CAZyme ID: MGYG000002059_00464
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	MGYG000002059_21|CGC1	56507.8	5.0048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002059	2037611	MAG	China	Asia

• Gene Location: Start: 4474; End: 6027 Strand: -

Full Sequence      

MKITLVRSMTRSAVFELVNSGCYRAPAPYTVTLDGAAVYEGDTNVFSLYSLEPGRQYTVA
VTIDGVTDTLVFTTAEESFFVDASRYGLVADGVTDNTARLQAALSTCPAGGTVYVPAGVY
RTQSLFLQSNTTLYLEKGCTLLGGTDRRDYPILPGVLPCHNEKDEHYLALWEGNPLDSFA
ALINVINAENVTITGEGTIDANAQNGDWYNNPKQKDIAWRPRLFFTNGAKNVVLHGVLVC
NSYSWTIHPAYSENVDILNIRIRNSSTSPNTDGIDPESCKNVNIIGNHVHVGDDCIALKS
SKLFLGMKLHVPCENVVIRNCCLSRGHGGLVIGSEMSGGVKNVTVTQCLMDHTDRGLRVK
TRRGRGKYAVIDGLVFRDVVMDGVLAPFVINMFYFCDPDGHSDYVQTHEPQPIDEMTPTL
GTLEMENITATDAQYAGCWFSGLPEQPIEGVKMRDVNISFAPDAKAGQAAMMCGADASCK
VGVHAENVHHIELHNVKITGYEGERLQLTHVDSYEED

Enzyme Prediction     

No EC number prediction in MGYG000002059_00464.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	105	473	2.4e-76	0.9507692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.58e-99	12	472	12	502	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	2.23e-27	184	462	46	307	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02218	PLN02218	5.20e-22	69	470	56	414	polygalacturonase ADPG
PLN03003	PLN03003	2.26e-21	81	470	24	368	Probable polygalacturonase At3g15720
PLN02188	PLN02188	2.08e-18	70	480	18	388	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB29658.1	1.33e-254	1	517	1	518
CBL00656.1	3.11e-253	1	517	1	518
ATP00558.1	8.43e-251	1	517	1	518
QIA43717.1	8.43e-251	1	517	1	518
AXA82452.1	1.39e-249	1	517	1	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	4.13e-44	86	461	33	413	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	8.07e-34	86	458	50	425	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
1BHE_A	8.17e-26	88	394	18	314	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
2UVE_A	1.68e-22	46	429	115	533	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1CZF_A	5.59e-10	80	384	4	280	Endo-PolygalacturonaseIi From Aspergillus Niger [Aspergillus niger],1CZF_B Endo-Polygalacturonase Ii From Aspergillus Niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27644	1.46e-46	234	447	35	249	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
A7PZL3	3.20e-41	86	465	68	431	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	4.42e-27	56	433	122	525	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P26509	6.33e-25	88	394	44	340	Endo-polygalacturonase OS=Pectobacterium parmentieri OX=1905730 GN=pehA PE=1 SV=1
P18192	2.13e-24	88	394	44	340	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000027	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002059_00464.