CAZyme Information: MGYG000002059_01043

Basic Information

• Species: Gemmiger sp900554145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900554145
• CAZyme ID: MGYG000002059_01043
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
919		103710.6	4.7873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002059	2037611	MAG	China	Asia

• Gene Location: Start: 3015; End: 5774 Strand: +

Full Sequence      

MLKLYDLTIEYKREPLGLDEVQPRFSWKLDTDRTGTVQTSYRIKVQRGGETVWDSGETES
AQSILVEYLGLNLEPRTEYTWNVTVWDNHGEESCAESRFETGLLRGDAFEGKARWITHTL
DKTSPVSPVLYREFTVSGPVAKARLYATALGMYEAEINGEKVDDTYFAPGWTNYRKRLQY
QTYAVPLREGLNRLTLTLANGWYKGKLGFMPQPNLYGDTTAALAALCITYADGREEWIGT
DENWLSTTGAIQSSEIYDGETQDFTAQPAAPQPAKLFDYGFDTIIGQENEPVRCLQRLPV
IKEFTTPKGEKVYDFGQNLTGWVEVEIYGEPGQTLTLRHAESLDENGNFYTENLSFAKAT
DTYILRGGKQTLHPHFTWHGFRYLCVEGLQYGQNVLFTACLLSTDLQQTGSFTCSDSRVN
RLQQNIQWSQRDNFLDIPTDCPQRSERLGWTGDVTAFCPTAAFNENIMPFMTKWLRDLAS
ELGPDVSMPQVVPNIMGNQQDGAAFWGDVVTVLPWTLYRAYGDKRILQSSYNSMKHWVDF
IESQCGKNGLWQTGYQYGDWLGLDAERSGLSDERKGATDDYLVANICFAWSLQILADTAH
VLGNAAEEHRWRQRREGLVKAFRAEYITPAGRLVSETQTALILALHFDMVPDEARPRLLA
ALEKNIGAHKTHLLTGFIGTPFACQTLSENGKHDLAGKLLLQEDNPGWLYEVKMGATTIW
ERWNSIQPDGSFNPANMNSLNHYAYGSIGSWLYTKLCGLEILESGYKRFALHPQFIQGIT
HAGLEYESVYGKIAVAWRCEGGKITVDATIPANTTAELTLPEQGETLTLGSGQYHYEYPT
ATDLRLDRYTMETPLHIIMEHPVARAIFAQYAPEFLENPMLEYVKNEPITALLAYGDSIR
PLFEQVLAAMNAAEKEHAQ

Enzyme Prediction     

No EC number prediction in MGYG000002059_01043.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	305	820	4.1e-174	0.9940476190476191
CBM67	113	269	5.7e-23	0.8465909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.63e-128	408	753	2	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.65e-49	138	293	1	169	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	3.57e-30	305	389	2	87	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.77e-20	758	827	1	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYH55287.1	0.0	2	917	1	916
QLG40468.1	0.0	2	913	1	909
QRT30265.1	1.63e-315	2	915	1	909
QRT50983.1	3.38e-300	2	912	1	911
VCV22853.1	1.55e-298	2	912	1	911

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GSZ_A	2.79e-178	2	836	2	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
3W5M_A	1.58e-169	2	821	4	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.27e-127	5	832	33	910	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	6.17e-169	2	821	4	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	6.56e-159	7	821	38	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.49e-147	15	821	43	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.72e-111	7	838	35	949	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002059_01043.