CAZyme Information: MGYG000002059_01044

Basic Information

• Species: Gemmiger sp900554145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900554145
• CAZyme ID: MGYG000002059_01044
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784		83814.32	5.4516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002059	2037611	MAG	China	Asia

• Gene Location: Start: 5771; End: 8125 Strand: +

Full Sequence      

MNEKVAEILSKMTLEEKISLCNGADFWHSKAMEQYGIPAITMSDGPHGVRCQKDASDMLG
VNRSEPATCFPTAVTSGATWDAALLKAEGKAIGEEGLSYGVDVVLGPGVNIKRNPLCGRN
FEYFSEDPCAAGAMGTAWVQGAQSSGAGTSLKHFAANNQEYKRFNGNSQVDQRTLRELYL
PAFEAVVKNAQPETVMCSYPRINNVHASDNTWLLTEVLRRDWGFDGLVVTDWGALCDRVK
AMHAGCDLSMPGGSNYMEDRVAAAVRDGSLPESDVDACAARVLALALKGEDRPKGKPLNK
DAHNRLAQKIAENGAVLLKNEGSILPLAETDIVLIGEMARTMRYQGAGSSHINPTMLTTL
CDALPAVPFNPGCDEKGNVTEESLAAAAAAAKQANIAVVCAGLPDIYESEGFDRETMAMP
EGHNRLIETVAAANPNTVVVLFCGCAVETPWLDKVKAVLYMGLPGQAGGAAVANLLTGKA
NPSGKLTETWPLCYADVPSRDTFGKKVTHYKEGLYVGYRYYDKAGKAVQFPFGYGLSYTQ
FAYSDLQIAGRTVTVTVTNTGHTAGAEVVQLYVAPPQDGIYRPAKELKAFAKAALQPGES
QTLTFALDDRSFAVWHDGGWQIPAGRYEILVGASSADIRLRGALDVDGVSLTAPAWQHGS
WYETLQGLPTDAEFAALYGGPVQNDTPLKKGSFTMEDSIMEMKDLSPIMMQMFKGTESTI
AKGFGGKADYSDPAFKMMVMSGADAPLRAAVLSSSGAFPANLAEGMLAMANGHPLKGVKK
LLKK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	251	9.6e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.70e-71	5	639	38	758	beta-glucosidase BglX.
COG1472	BglX	6.26e-68	36	336	59	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.89e-61	8	547	56	642	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.70e-55	315	518	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.91e-41	29	285	56	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX00396.1	3.48e-272	12	784	1	747
AGC67350.1	1.40e-271	12	783	1	746
ANW97844.1	1.40e-271	12	783	1	746
AGI38411.1	1.40e-271	12	783	1	746
QFZ20634.1	3.56e-234	10	784	11	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.96e-198	5	679	5	698	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.36e-183	1	667	1	687	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.49e-124	3	646	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.25e-123	3	646	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	2.46e-101	5	638	6	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.62e-197	5	679	5	698	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	1.56e-177	1	676	1	705	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	6.95e-176	1	676	1	705	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P27034	4.88e-124	5	639	2	803	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BFG8	9.15e-119	4	638	10	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002059_01044.