CAZyme Information: MGYG000002059_01416

Basic Information

• Species: Gemmiger sp900554145
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Gemmiger; Gemmiger sp900554145
• CAZyme ID: MGYG000002059_01416
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622	MGYG000002059_129|CGC1	69975.07	6.2514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002059	2037611	MAG	China	Asia

• Gene Location: Start: 2744; End: 4612 Strand: -

Full Sequence      

MLEKPNNERPADLAVQDSVGGMAKRLLNPAHLRDLATRSVHTLQEQGAEQLWRDVKFRVG
LALHHDDWRHRADIPLRRELKAQRVAKLQGPTISIIVPLYNTPAKFFDEMLKSVIQQTYT
HWELVLVDASDAGKRLESRLPKAVPGTIVYEAVENGGIAANTTRGFELAHGDFIALLDHD
DVLYPNALFEVVQTLQSTGADFVYSDEIVLSANLKELGGYHFKPDFAPDYLRGVNFITHL
AVFSRPLLDAAGAYESKEFDGAQDHDLILRLTEKAQHIEHIKKVLYIWRGHAGSTAAGME
AKPYAVAAGERAIDAQLQRLGLPGHAMAVPDAPGAFQVRYELTGHPKISVLIPNKDHVED
LDRCLTSLYKNAGYDNFEVIVIENNSTDPATFAYYKTLHDKFPTCWVVTFEGHGPFNFSA
INNFGASFAEGEHLLLLNNDIEILSHDFLRELLSYSQRPDVGAVGAKLYYPDDTIQHAGV
LMGINGSAGHSHKSYPRTAVGDMYRLVTTQDYMAVTGACLMTKATLWKELGGLDEEKFAV
AYNDVDYCLKLWQKGLLNVYTPRAEAYHYESKSRGLDTLSENARRYEREKANFYAKYKQY
IDNYDPYYNPHFNNLFENFGLK

Enzyme Prediction     

No EC number prediction in MGYG000002059_01416.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	94	204	2.5e-19	0.6588235294117647
GT2	346	573	7.7e-18	0.9304347826086956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.12e-71	91	289	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.58e-38	350	570	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.19e-30	346	600	3	250	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	4.67e-23	94	295	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	9.75e-19	94	248	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO22278.1	8.55e-165	93	607	98	614
QMW89744.1	6.38e-164	14	622	6	615
BBK78193.1	6.38e-164	14	622	6	615
CDM69534.1	2.46e-163	74	607	224	757
QUC66692.1	2.78e-161	94	622	419	946

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.20e-113	82	589	356	866	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	4.85e-86	75	581	302	805	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2UR96	1.17e-08	93	203	5	116	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q68X33	1.33e-08	90	195	7	109	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1
Q9ZDI9	1.77e-08	88	195	5	109	Uncharacterized glycosyltransferase RP339 OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=RP339 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002059_01416.