CAZyme Information: MGYG000002061_00598

Basic Information

• Species: QAMX01 sp004555605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAMX01; QAMX01; QAMX01 sp004555605
• CAZyme ID: MGYG000002061_00598
• CAZy Family: GH92
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684	MGYG000002061_11|CGC1	75505.79	5.3205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002061	2191757	MAG	China	Asia

• Gene Location: Start: 7337; End: 9391 Strand: -

Full Sequence      

MHLISDVNVFQGCGAIDLPAPQGVAASWHFIKALCGNTHPGAVRPFGKLSACCYSAGYSA
GYGHHRINCGGPIRPLWDSDRFIGISHMHQSGIGALGFYENYALTIPFCGTLTAETAVRG
IRSESAEPGYYAVTSSDGIRSEVTVSPRCARHRYTFPASGGRIAIDFTNDGLYEGENVAS
RPKSWRVERLSASEAAAEAVLQGVCVSFYVSCRGSTGCTLWRGSALTDADRLSACGAAAE
ERGGCCFDLAEQTAELVVSVSLRGERQARKAAEAETASFETVREEAHRAWAERLSHIEIE
TADDREREIFASNFYHSLVKPSDWQDESFLYRQEDFMLDFCTLWDQYKTQLPLIFTLFDD
ISGKIVSTYEALSETLGFLPHTFVLCDQFRIEAKQAQMLGVYVLYDAFCRGIGDPESLLA
AIRRDLTRPEYRPFFETGVCEKTTHTLDMAEGCLAAAELARACGDTALANHLESSAQSVW
QAFDPATGLLRADADYYEGNHWNYSFRPMRDMRKRIALTGSAEAFVRLCDRFFGFTEAAD
TTARFEGFNNETDMEAPYAYLYAGRHDRLCDVLTDGLDSMFTTGRGGLPGNNDSGGLSSC
YLWNALGVFPVSGQNKMLIGTPRFEQAVLHLSGGRDFQIVRRGRGRYVREAKLNGVPIQN
FQFSVRQMMSGGTLELTMSEQPVC

Enzyme Prediction     

No EC number prediction in MGYG000002061_00598.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH92	250	682	1.7e-77	0.9735234215885947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07971	Glyco_hydro_92	1.74e-81	267	679	1	464	Glycosyl hydrolase family 92. Members of this family are alpha-1,2-mannosidases, enzymes which remove alpha-1,2-linked mannose residues from Man(9)(GlcNAc)(2) by hydrolysis. They are critical for the maturation of N-linked oligosaccharides and ER-associated degradation.
COG3537	COG3537	1.23e-75	36	682	57	743	Putative alpha-1,2-mannosidase [Carbohydrate transport and metabolism].
pfam17678	Glyco_hydro_92N	2.81e-24	36	170	12	142	Glycosyl hydrolase family 92 N-terminal domain. This domain is found at the N-terminus of family 92 glycosyl hydrolase proteins.
NF035929	lectin_1	4.99e-20	37	682	22	684	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZD53875.1	1.71e-131	2	682	7	725
QQQ80618.1	1.78e-131	3	682	1	723
QJW36675.1	4.07e-130	3	682	1	716
QDV59070.1	6.27e-129	7	679	22	728
BAK36400.1	1.18e-128	7	682	5	716

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F8Z_A	1.42e-30	7	682	11	714	Structureof the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F8Z_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F90_A Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_B Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F90_C Structure of the family GH92 alpha-mannosidase BT3130 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]
6DWO_A	1.86e-19	344	682	312	697	Crystalstructure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_B Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_C Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583],6DWO_D Crystal structure of alpha-1-2-mannosidase from Enterococcus faecalis V583 [Enterococcus faecalis V583]
7FE1_A	1.86e-19	344	682	312	697	ChainA, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE1_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
7FE2_A	4.28e-19	344	682	312	697	ChainA, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_B Chain B, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_C Chain C, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100],7FE2_D Chain D, Alpha-1,2-mannosidase [Enterococcus faecalis ATCC 10100]
6F91_A	1.54e-16	36	682	21	726	Structureof the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_E Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_F Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_G Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F91_H Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],6F92_A Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_B Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_C Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron],6F92_D Structure of the family GH92 alpha-mannosidase BT3965 from Bacteroides thetaiotaomicron in complex with Mannoimidazole (ManI) [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4ATR3	2.71e-19	36	681	44	743	Uncharacterized secreted glycosidase ARB_07629 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07629 PE=1 SV=1
O86365	6.43e-18	37	682	62	753	Uncharacterized glycosidase Rv0584 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0584 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996621	0.003343	0.000051	0.000007	0.000003	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002061_00598.