CAZyme Information: MGYG000002061_01279

Basic Information

• Species: QAMX01 sp004555605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAMX01; QAMX01; QAMX01 sp004555605
• CAZyme ID: MGYG000002061_01279
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000002061_36|CGC1	41752.47	5.7713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002061	2191757	MAG	China	Asia

• Gene Location: Start: 3104; End: 4222 Strand: -

Full Sequence      

MIKVGIVGARAQTTLTGFRELENVEVTAVCDLNEECMNHIADEFQIEHRYRVFDDMLESD
IDAVVIATPMQCHVPQAIAALEAGKHVLSEVTAGVTMDELWWLIETKEKYGKTYMMAENN
IYTPEVQLVKSLRDAGKFGTPFYAEGEYLHDVTDLAVYPNGKRSWRTYWQLGKRGAFYPT
HSLGPVMTWFSGDRVAEISCFGTGGQYLRPDLKQDELTVTMCRMASGALAKITVACKAPR
PHNTLGALLQGTKGCYESPRGLGDDHKIWLADESDACKWRPLHDFDAYLPERYRHPTEAA
KTAGHRGGDYFQVKHFVDAILSGEEPEVDVYRACEWTAVGLLSELSVTNGGRTMEVPNFR
KNMPSAEKRIKL

Enzyme Prediction     

No EC number prediction in MGYG000002061_01279.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	361	4.2e-92	0.9699248120300752

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.73e-42	1	358	3	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	5.06e-16	2	117	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.64e-06	53	145	60	149	putative oxidoreductase; Provisional
PRK13304	PRK13304	4.72e-06	1	124	1	119	aspartate dehydrogenase.
smart00881	CoA_binding	0.005	4	84	11	89	CoA binding domain. This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE96970.1	4.45e-166	1	372	1	374
QHW33651.1	1.64e-158	2	372	3	382
QHW35532.1	7.42e-157	2	372	3	381
QHT62446.1	1.26e-155	2	372	3	382
BBH24596.1	9.67e-153	2	372	3	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	6.35e-36	7	359	28	426	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	7.98e-31	7	361	50	435	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
6A3F_A	1.85e-13	29	288	61	339	Levoglucosandehydrogenase, apo form [Pseudarthrobacter phenanthrenivorans Sphe3],6A3F_B Levoglucosan dehydrogenase, apo form [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_A Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_B Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_C Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3G_D Levoglucosan dehydrogenase, complex with NADH [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_A Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_B Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_C Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3I_D Levoglucosan dehydrogenase, complex with NADH and levoglucosan [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_A Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_B Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_C Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3],6A3J_D Levoglucosan dehydrogenase, complex with NADH and L-sorbose [Pseudarthrobacter phenanthrenivorans Sphe3]
3EVN_A	7.00e-13	2	276	6	268	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
4HAD_A	2.71e-11	19	156	44	182	Crystalstructure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_B Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_C Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_D Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1RI61	6.23e-46	1	361	54	445	Glycosyl hydrolase family 109 protein OS=Shewanella sp. (strain W3-18-1) OX=351745 GN=Sputw3181_1518 PE=3 SV=1
A4Y8C8	8.69e-46	1	361	54	445	Glycosyl hydrolase family 109 protein OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) OX=319224 GN=Sputcn32_2490 PE=3 SV=1
A8H2K3	2.27e-44	2	361	53	442	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1
Q0HKG4	2.40e-44	1	361	54	445	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-4) OX=60480 GN=Shewmr4_1375 PE=3 SV=1
Q0HWR6	2.40e-44	1	361	54	445	Glycosyl hydrolase family 109 protein 1 OS=Shewanella sp. (strain MR-7) OX=60481 GN=Shewmr7_1440 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002061_01279.