CAZyme Information: MGYG000002061_01701

Basic Information

• Species: QAMX01 sp004555605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAMX01; QAMX01; QAMX01 sp004555605
• CAZyme ID: MGYG000002061_01701
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
536	MGYG000002061_70|CGC1	60844.7	5.3886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002061	2191757	MAG	China	Asia

• Gene Location: Start: 5653; End: 7263 Strand: -

Full Sequence      

MHIRIPDLISVYTETGRQDFRSDCGRFEDVSYQLTLKNDAVSVDITADVTPICYLRLRWH
FTEAERRDEMLRIYGDAWERGGGELEWRGIVPERCMPWFTLVSNGTDRHQARSGRLTEAF
GVRVRPAAFCFWQYDADGLTLWMDVRCGGKGVLLGGRTLHAGEILFRTYENCTAFEAGQR
FCKEMSPEPLTMAHPVYGSNNWYYAYGDSSHEAILEDARNTAALCAGLKNRPYMVIDDGW
SPNPKNGPWTHGRASFPDMPGLAAEMKKLGVRPGIWTRYIADEGQVCNLPAEWHVERDDN
YLDPSHPDVLNYIRETTKRFCEWGYELIKFDCSTQDILGRRGYRVPNVIAEDGWAFYDRS
KTSAEIVLNFYKTIRETAGKDVVLIGCATISHLTAGLVELGRTGADVNGRSWDITRKMGV
NTLAFRMMHHGSFFAADADCIGISGGISWENNRKWLKLLSESGTPLFVSCKPGILNEAQL
EELRTAYRHGADQTDTLIPLDWMENICPRFYLMNGQEVSFDWFDDSFGCGFDGLTK

Enzyme Prediction     

No EC number prediction in MGYG000002061_01701.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.91e-29	195	484	2	291	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.50e-07	183	331	280	450	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14790	GH_D	4.55e-05	202	443	8	206	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.
cd14792	GH27	0.007	201	332	6	124	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNU96820.1	3.26e-171	3	530	8	527
QIB59833.1	2.60e-163	1	526	6	529
BDA09953.1	5.20e-163	1	526	6	529
QCU01578.1	2.08e-160	5	525	30	542
CBL19648.1	2.08e-160	5	525	30	542

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002061_01701.