CAZyme Information: MGYG000002061_01928

Basic Information

• Species: QAMX01 sp004555605
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; QAMX01; QAMX01; QAMX01 sp004555605
• CAZyme ID: MGYG000002061_01928
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727		82397.83	5.3904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002061	2191757	MAG	China	Asia

• Gene Location: Start: 153; End: 2336 Strand: +

Full Sequence      

MTSKEMFGNALWLETSEKIDVPHIRGEFSAASPVQHAEITISGLGMFALYINGNRVGDDL
YGTLASDFHETEHAYCTSEYGEHLGHRIYAKQLDITDLVAEQNCIGITLAPGWYRNKENN
YGSPKLCFRIMLTDANGQTAEILSGDWLHWTQSEIVSWDFYHGEHHDYSAIHLDGWMLPG
YDASAWHPMVAVAAPESSYLLSDCPPDRIIRCITPKLIAETDTEFLYDMGENITGTPVLE
QRTGGSCKMTLRVSERLEAGRRIEAYTNHGQNASFVTDGWKRQYRLRFCWFGFRYAAVSK
NARIVSCEVSHADVPVSSSFRSSNPLLNWMYETYLRTQLDNMHCGIPSDCPHIEKRGYTG
DGELVCECAMMMLDAKPFYKKWLGDIADCQDRVSGHIQYTAPYVRSGGGPGGWGCAIAEV
PYIYYKMYGDESVLADFLPQVLRYFDYLEAHSENDLVVSDQKNEWCLGDWCTPEEIVIPE
PFVNNYFYIRTINRLLEFCRVLNRNDLVPELTALAERKKAAIVRTYFDAQTGDFCRNVQG
ANAFAVDLGLGDDRTFANMVRHYEQNTWFDTGIFGTDIVTRVLFERGHATLAYRLLTSEE
KYSFWHWQSTGCTTFPEYWTYNRSQNHPMFGAVIKYLFRFILGITQEGAGWKNIVVAPKF
ADGLNSAEGSILTESGRVSVRFVRSAGRVSFRIEIPEGVQARLAYAGSHPLTAGIHEFSL
PEETTAR

Enzyme Prediction     

No EC number prediction in MGYG000002061_01928.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	221	703	1.6e-110	0.9861111111111112
CBM67	17	196	6.9e-16	0.9090909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.21e-64	318	641	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.44e-26	33	211	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	2.77e-12	643	703	1	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	4.06e-05	222	302	5	88	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	3.30e-184	7	720	3	724
BCJ98018.1	1.07e-112	12	696	127	849
QOY86540.1	7.77e-111	22	708	152	845
QGA23405.1	6.94e-93	22	701	177	863
BCG53442.1	1.52e-91	15	701	168	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	8.60e-61	22	696	177	889	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.91e-54	34	710	316	999	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.33e-37	18	718	124	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.59e-55	23	703	186	904	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.53e-53	34	710	316	999	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
P9WF03	1.08e-48	23	721	172	894	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	8.19e-37	23	703	176	876	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002061_01928.