CAZyme Information: MGYG000002062_01620

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000002062_01620
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000002062_42|CGC1	44250.33	6.1258

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002062	2018168	MAG	China	Asia

• Gene Location: Start: 5759; End: 6961 Strand: -

Full Sequence      

MNKFTTSLMSLALAASFAGVQTVQAEEKAATAAPAPAQAAAAPAALAPVRSLNKAPTDTW
PAWKEFRKSALEKGRVIDRSDDRLITTSEGQSYGMFFALVANDRPSFDAMWQWTVANLCE
GDCGKTRMAWLWGASESVKDAKNPVKWGVIDSNNATDADLWIAYSLLEAADRWENPKYRD
DAMALLERVKQDVRVVRGLGAVLLPANVGFEKNGNVVLNPSYYPISVLKRLEAVDPLWRE
VRWGSMRALLRSAESGLSPDWVAFGQRWGTRNRDESSEGSWNAIRVYLWAGMMPQDDPDA
IRLRDLLSPMVDVTRARYLTPVSTDTAAFTVSQKGPLAFGACVLPWVRDERVGAYIRTSL
STMALTGEDYYRSVLVMFGMGFDEGRFAFGHDGRLIIKGD

Enzyme Prediction     

No EC number prediction in MGYG000002062_01620.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	60	382	4.3e-75	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	4.64e-119	51	396	16	365	cellulase.
COG3405	BcsZ	1.45e-73	58	389	24	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	9.48e-56	57	385	1	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53782.1	1.18e-110	60	396	71	408
QDA53874.1	7.03e-106	46	398	10	361
QQS88762.1	2.14e-102	60	397	28	361
ANU67169.1	7.77e-94	56	400	18	353
QQQ96024.1	7.77e-94	56	400	18	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	8.42e-86	59	396	3	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F81_A	2.11e-82	59	395	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	5.93e-82	59	395	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	7.50e-81	59	396	3	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]
4Q2B_A	1.76e-80	57	396	1	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	1.53e-86	59	396	24	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	2.43e-85	59	396	24	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8ZLB7	2.23e-83	51	396	17	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	3.53e-82	51	396	17	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P58935	2.33e-67	44	396	16	372	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000468	0.998736	0.000216	0.000222	0.000181	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002062_01620.