CAZyme Information: MGYG000002063_00859

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000002063_00859
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		65812.71	5.2787

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002063	2224261	MAG	China	Asia

• Gene Location: Start: 8476; End: 10284 Strand: +

Full Sequence      

MLSAAAFTTVMGQDRTPAFPGAEGFGRYATGGRGGNVYYVTRNDDCTDNNLVEGTLRWAL
RTGDDTPRTILFKTSGTIYLNSVLKFAHPNVTIAGQTAPGGGICIAGYNIYVCKPNVILR
HLRFRAGDLAAKSRTALDIENTRNVIIDHCSMTWSMEECMTMYDCDSTTVQWCIIGEGLY
NSRNAKGARSYAMQWGGEHTSMHHTLITNCNNRMPRFNGVRSESKNRGDHDQFVDSEFFN
NVIFNWGKSNSLYGGECYTAINEGNSYNRVYVRGNYFRPGPNTQKNVQKNRYFFQGDNST
QGTGQWLVEGNMFEKGNPYATTKNSCWTDATLDKVNADNWYGFTTNSADKAVNLGVGNNQ
ANYDLYALTEQTVKSGLTAEPAADAYTKVVGRNQSSEVYYCAGATHPRLDEVDTRLLAEA
AGEIEPQFAGRDANGNLSRGMGIIDSPADVTLAEHDTFDALHETTGQGVGEVKTTTLWPY
LGLREGDRLIEDTDGDGLPDVYERKKGLNPNDASDGAALTPEGYSNLEVFLNGVADGSID
KSEYETIESGMAKTKVGDVRTVSRTYYNIGGVETAAKSATGVSIVRENHADGTVSVRKVA
GR

Enzyme Prediction     

No EC number prediction in MGYG000002063_00859.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	75	267	1.5e-63	0.9890710382513661

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	3.38e-05	16	283	28	279	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	0.001	69	217	3	151	Amb_all domain.
pfam18884	TSP3_bac	0.004	492	513	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
pfam00544	Pec_lyase_C	0.005	90	219	35	178	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75604.1	9.51e-149	18	536	38	534
QNA45667.1	5.96e-94	1	532	8	457
QGW28869.1	1.03e-91	15	532	21	457
ALJ01754.1	2.16e-91	13	535	14	461
AEV99914.1	3.39e-88	1	534	16	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	1.93e-08	23	268	46	272	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WL88	1.23e-30	1	532	8	412	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B8NQQ7	1.65e-30	18	538	22	417	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
B0XMA2	1.67e-30	1	532	8	412	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
A1DPF0	7.70e-30	1	532	8	412	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q2UB83	8.67e-29	18	538	22	417	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.898184	0.101139	0.000220	0.000208	0.000104	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002063_00859.