CAZyme Information: MGYG000002068_01755

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UMGS1766
• CAZyme ID: MGYG000002068_01755
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		36131.59	5.6655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002068	2463364	MAG	Netherlands	Europe

• Gene Location: Start: 649; End: 1569 Strand: +

Full Sequence      

METISPWRFDVARNRSLELVPEDADICVCTDLDEVFTAGWRQALERAWTPECTQVRYHYI
WNFRPDGGDGISFWGDKIHARQGWRWVNPVHEVLRCEGQPRAVFADEIRLEHHADDTKSR
GQYLPLLELAVQEDPENDRNMHYLGREYMFYGRWQEAIDTLKRHLSLPSATWAEERCASM
RYIARCEQARGHQGEAERWLLRACGEAPNLREPWLDLAKFCYQKEDWYGVAYAARRALEI
RRRSETYLSEPEAWGEAPYDLMAIALYYTGDYSHALAMGEEALRRSPMDRRLRENLRLIR
QKAEQN

Enzyme Prediction     

No EC number prediction in MGYG000002068_01755.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
sd00006	TPR	6.02e-04	180	284	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	0.001	141	239	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	0.003	124	203	21	95	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
COG0457	TPR	0.005	124	306	115	286	Tetratricopeptide (TPR) repeat [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA29496.1	2.05e-133	2	299	54	354
ANU42689.1	5.85e-133	2	299	54	354
QQR04409.1	5.85e-133	2	299	54	354
AQS58818.1	2.61e-119	4	306	59	363
AQS58819.1	4.56e-113	4	304	59	361

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002068_01755.