CAZyme Information: MGYG000002072_01188

Basic Information

• Species: SFFH01 sp900542395
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; SFFH01; SFFH01 sp900542395
• CAZyme ID: MGYG000002072_01188
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000002072_6|CGC1	38039.24	8.9812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002072	2856300	MAG	Netherlands	Europe

• Gene Location: Start: 82132; End: 83193 Strand: +

Full Sequence      

MKRIVLTGGGTAGHVSPNQALIPHLLEEGWDIHYIGTKNGIERTLIEPMQGVTYHAVSSG
KLRRYFDWKNFTDPFRVIAGAFQSIGVIGRLKPNVVFSKGGFVSVPVVFGAAICGVPVVM
HESDITPGLANKLCKPFAKSVCTTFPECAKLLAPKGVLTGTPLRAQIFSGDRARGLRLAG
FDGQKPVLMMIGGSLGAQTVNAVLREALPALTKRFDVLHVCGKGNLDASLENTPGYKQFE
YLSDELPDAFACADIMLSRAGSNSLSELMALCKPALLIPYHSGRGDQVLNANSLKARGLA
HVMPQSELTAESLPPAIDALWADRELLRQRLAALPDADGTQLVLDQIHKYMKK

Enzyme Prediction     

No EC number prediction in MGYG000002072_01188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	332	4.8e-38	0.9235668789808917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	3.14e-142	1	349	1	351	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	2.26e-138	1	353	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	6.46e-114	3	345	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.57e-108	2	353	1	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.20e-90	2	347	1	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE70149.1	4.46e-161	1	352	1	354
QUC66253.1	1.28e-160	1	352	1	354
QTE74121.1	1.81e-160	1	352	1	354
QTE69037.1	1.81e-160	1	349	1	351
QUA52094.1	1.53e-159	1	353	1	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	2.08e-45	4	345	5	349	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	3.98e-45	2	349	7	352	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	5.53e-36	2	349	10	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
6KQW_A	8.96e-08	215	353	250	387	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	9.07e-08	215	353	250	387	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97GY4	1.43e-130	3	352	5	356	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=murG PE=3 SV=1
A4IJS4	2.43e-128	2	344	3	348	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=murG PE=3 SV=1
A0Q182	2.70e-125	3	352	5	357	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium novyi (strain NT) OX=386415 GN=murG PE=3 SV=1
Q893R7	5.62e-125	2	350	3	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=murG PE=3 SV=2
A5MZ55	7.74e-124	1	350	1	352	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) OX=431943 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002072_01188.