CAZyme Information: MGYG000002079_00035

Basic Information

• Species: Succiniclasticum sp900315805
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Succiniclasticum; Succiniclasticum sp900315805
• CAZyme ID: MGYG000002079_00035
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276		30336.84	6.2302

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002079	2004853	MAG	Netherlands	Europe

• Gene Location: Start: 37906; End: 38736 Strand: -

Full Sequence      

MQKQTTLAASISYSGNGLHSGKPVTMTLKPAAPDTGIVFIRTDLPDQPEIHAKAELVTST
LRATTISENGAQVFTVEHLLASLAMMHVDNCHIEMNSPEPPVADGSGLVFAQLVLKAGRK
EQDAERKVYKVDRAFSVYDGDKYIVMLPYDGVRISFTSINPHPLLGTQYKDVELTEESFL
KEIAPARTIGFMNEVEQMKKMGLGLGGNLENAVVYDDTKCLSVPRFPDELVRHKILDVLG
DLFLLGPWEGHVIAVKSGHAYNSQLAKQIIAYREGK

Enzyme Prediction     

No EC number prediction in MGYG000002079_00035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	4	270	1.8e-97	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	6.12e-149	4	271	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	5.13e-138	1	271	1	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	1.33e-117	1	271	1	277	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13188	PRK13188	9.19e-104	1	272	2	301	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
TIGR00325	lpxC	6.75e-95	3	274	2	276	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78319.1	5.17e-130	4	273	9	278
QNP78243.1	3.43e-129	4	273	2	271
BBG63219.1	5.59e-129	4	273	6	275
ADB48045.1	4.72e-120	2	273	4	275
ARF98934.1	2.37e-118	4	270	5	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J3D_A	1.12e-74	1	274	1	279	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
5U3B_A	1.20e-74	1	274	1	279	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]
7K99_A	1.35e-74	1	274	1	279	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]
5UPG_A	1.39e-74	1	274	2	280	Crystalstructure of LpxC from Pseudomonas aeruginosa in complex with PF-5081090 [Pseudomonas aeruginosa PAO1],6C9C_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with racemic ligand PT803 [Pseudomonas aeruginosa UCBPP-PA14],6CAX_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT805 [Pseudomonas aeruginosa],6DUI_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with PT801 [Pseudomonas aeruginosa LESB58],6E54_A Crystal structure of LpxC from Pseudomonas aeruginosa in complex with ligand PT802 [Pseudomonas aeruginosa PAO1]
2VES_A	1.69e-74	1	274	1	279	CrystalStructure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_B Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_C Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],3P3E_A Crystal Structure of the PSEUDOMONAS AERUGINOSA LpxC/LPC-009 complex [Pseudomonas aeruginosa],3U1Y_A Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3U1Y_B Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3UHM_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase in complex with inhibitor [Pseudomonas aeruginosa],4LCF_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-014 complex [Pseudomonas aeruginosa PAO1],4LCG_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-050 complex [Pseudomonas aeruginosa PAO1],4LCH_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-051 complex [Pseudomonas aeruginosa PAO1],4OKG_A LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],4OKG_B LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],5DRQ_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-040 complex [Pseudomonas aeruginosa PAO1],5DRR_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-058 complex [Pseudomonas aeruginosa PAO1],6I46_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I47_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I48_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_BBB Chain BBB, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I4A_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],7CI4_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI4_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_C Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_D Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI7_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI9_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIA_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIB_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CID_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7DEL_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEM_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEN_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47AB0	5.34e-77	1	270	1	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Dechloromonas aromatica (strain RCB) OX=159087 GN=lpxC PE=3 SV=1
Q1D2K0	1.41e-76	4	271	8	278	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxC PE=3 SV=1
C1D5L0	1.18e-75	1	271	1	277	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Laribacter hongkongensis (strain HLHK9) OX=557598 GN=lpxC PE=3 SV=1
A6VB79	1.84e-74	1	274	1	279	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=lpxC PE=3 SV=1
Q1GZ08	6.28e-74	1	271	1	276	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=lpxC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999471	0.000561	0.000007	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002079_00035.