CAZyme Information: MGYG000002080_00373

Basic Information

• Species: Prevotella sp900544825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900544825
• CAZyme ID: MGYG000002080_00373
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000002080_4|CGC1	38973.13	9.6219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002080	3221264	MAG	Netherlands	Europe

• Gene Location: Start: 38783; End: 39814 Strand: -

Full Sequence      

MKERRLCYISRTYYNQTSAGNKAKTDYEKVLHSMGAASIGLPCKIDNNKFLAFFYNLAST
LIACSRIQKGDVIVLQYPVKKYFSFICKMAHLKGAKTISLIHDLGSFRRKKLTVAQELKR
LSHTDYIIATNQAMKLWLEQQGLEKPIGALGFHDYLSPAVAANKKHQPNEVWNIVYAGSL
NLRKNAFILKMQELDYQFKFHLYGNMEDYDAVAKDKNIVWHGFMNADDFIKQVRGNFGLV
WDGDSLDECHGDFGSYLKYNTPHKASFYLRTGLPIIVWKESAIASLVEERGVGFAINSLK
ELPICLKNISTEEYSAMLTKVKQLAIAINNGNNLKKAIEESKL

Enzyme Prediction     

No EC number prediction in MGYG000002080_00373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	14	340	1.5e-93	0.9751552795031055

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	6.17e-67	18	340	15	328	sugar transferase.
cd03794	GT4_WbuB-like	2.50e-11	50	340	79	379	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85168.1	5.26e-114	4	340	3	338
ALJ61055.1	5.24e-101	8	341	5	338
QUT93412.1	5.24e-101	8	341	5	338
QUT49973.1	3.46e-95	28	341	2	314
QQT78203.1	3.67e-85	6	341	2	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	4.83e-11	67	341	64	325	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	5.01e-11	67	341	72	333	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	4.75e-32	67	340	60	322	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
Q9AEU1	1.01e-18	70	338	65	325	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
A0A0H2UR93	1.24e-17	23	341	20	329	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
B3XPQ7	1.73e-12	67	341	62	328	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	1.14e-10	67	341	67	333	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999939	0.000093	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002080_00373.