CAZyme Information: MGYG000002080_01165

Basic Information

• Species: Prevotella sp900544825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900544825
• CAZyme ID: MGYG000002080_01165
• CAZy Family: GT23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000002080_19|CGC1	31031.98	8.6558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002080	3221264	MAG	Netherlands	Europe

• Gene Location: Start: 10374; End: 11189 Strand: +

Full Sequence      

MEIKLIPTGGLCNRLRAIATTIAIAKHYQCSLSIYWNNSIGLKANFADLFEPIHIEKVHL
IENTQWLYRINGTKDYLLRKWFLRLGNEQVVFNHSIYTQGDIYQKLKSHYKGNLLLISCY
PMCTDYQIKNIFVPKRDLQLQIDQITSIFSKHVIGVHIRRTDNIASINSSPTDVFVHLMQ
LEIEKEDTVKFYVASDDEEVKKELQGKFPGRVITLMDDTSRDSLEGMKFAVVDLFCLSKT
KKILGSVASSYSQIAAEIGGIKIEYAKCNKN

Enzyme Prediction     

No EC number prediction in MGYG000002080_01165.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT23	9	258	9.3e-23	0.8270440251572327

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11548	NodZ_like	3.40e-27	7	265	6	287	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11301	Fut1_Fut2_like	1.98e-09	8	213	8	205	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11300	Fut8_like	2.70e-08	128	258	159	307	Alpha 1-6-fucosyltransferase. Alpha 1,6-fucosyltransferase (Fut8) transfers a fucose moiety from GDP-fucose to the reducing terminal N-acetylglucosamine of the core structure of Asn-linked oligosaccharides, in a process termed core fucosylation. Core fucosylation is essential for the function of growth factor receptors. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	8.44e-05	122	258	39	200	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65604.1	4.57e-126	1	267	1	267
QCQ42391.1	2.43e-45	1	263	1	262
QRM71701.1	2.70e-44	1	263	1	262
QJR65871.1	1.46e-43	2	267	3	275
QJR70901.1	1.46e-43	2	267	3	275

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000020	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002080_01165.