CAZyme Information: MGYG000002080_01891

Basic Information

• Species: Prevotella sp900544825
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900544825
• CAZyme ID: MGYG000002080_01891
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	MGYG000002080_40|CGC1	61195.91	8.3228

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002080	3221264	MAG	Netherlands	Europe

• Gene Location: Start: 8645; End: 10288 Strand: +

Full Sequence      

MKIKSFLMAALAAFSLSASAQSLSPGTKWHWDKGTIVVETPERPAGQQNVLGLTAPKLKT
VRVGFVGLGMRGPWAVMRFCHIPGVEIVALCDYEEARAEKSQEYLRKQGLKPADIYSGAK
GYEALCKRSDIDLVYIAADWNHHFPVAKFAMENGKHTAIEVPSAMNLDQCWSLINLSEQT
RKHCFILENCCYDYYEMNALAMAQDGVFGDIIRAEGAYIHCLEDFWDAYWKDPADNDKDN
LHWRMKYNMENRGDVYPTHGLGPVAQCLNIHRGDRFTTLVAMDTESFVGKDWVKNKSSKE
CKEFRNGDHTTTLMRTAKGKVVEIQHNVMTPQPYNRLFKLTGTKGYATKYPTEEFALSGE
ALKGTGAPQMDNLNAHGFMNKEQKEALIKKYYHPILKKYGELGRQMGHGGMDFIMDSRLV
YCLQNGLPLDMDVYDLAEWCSLAELGALSMDNNSAAVTFPDFTRGFWNKQDGYKHQYASP
EAEAATEAAAAAYTKSQKEATAKFKLWNLYDAVAAAKKANNAKALKSATAKYNKAVAAAK
KAMNAKK

Enzyme Prediction     

No EC number prediction in MGYG000002080_01891.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	57	469	4.6e-152	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	5.56e-21	59	371	2	281	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	6.72e-12	61	186	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.49e-05	60	211	4	145	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR38645.1	4.24e-306	1	526	1	527
QQY38775.1	4.24e-306	1	526	1	527
QCQ31109.1	9.73e-265	10	505	17	504
QFQ13386.1	6.12e-264	2	511	5	516
QPH58140.1	3.07e-257	12	503	17	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	4.73e-90	43	467	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	8.93e-68	59	467	19	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E82_A	2.34e-06	60	218	7	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KYY1	8.49e-307	1	526	1	527	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6L1Z2	9.54e-257	17	503	24	509	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	2.44e-251	2	503	3	508	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
Q89ZX8	7.35e-190	3	478	1	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
P0C863	3.54e-187	6	478	9	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000329	0.998803	0.000211	0.000233	0.000220	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002080_01891.