CAZyme Information: MGYG000002082_00053

Basic Information

• Species: Alistipes sp900544265
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900544265
• CAZyme ID: MGYG000002082_00053
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000002082_1|CGC1	45860.04	5.4523

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002082	2573115	MAG	Netherlands	Europe

• Gene Location: Start: 56993; End: 58222 Strand: -

Full Sequence      

MKRPFFAALLCAVAALAACSSHPTRPALLDGPTPLAVRVVESEIARTPSAANLDGIPAGK
IKWNYTTGLELLAMMDAGEAYGRTDFRDYAQRYYDSIVQPDATVLTYRREKYNLDHICPG
RALFRLAESSGEARYRQVLDTLYAQLQGQPRNADGGFWHKAVYPHQMWLDGLYMAEPFYA
EYAMTFLDGAERERAVADIVNQFVVVAKHTYDPQTGLYRHAYDDSRAMFWCDSLSGQSAH
AWGRAMGWYAMAIVETLQYLGVDAATQPMVDILHRIYEVLPRYADPETGMWYQVLDQPGR
EGNYLESTASAMFVYAMLKGVRLGHLPAELGPDAQRAFERLVERFVRENPDGTVSLTDCC
AVAGLGGKQRRSGTFDYYISEKVIDNDCKGIGPLIWAAMEYDRALGRLE

Enzyme Prediction     

No EC number prediction in MGYG000002082_00053.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	61	402	3.8e-110	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.45e-91	36	405	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.50e-87	63	405	34	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63671.1	8.78e-222	1	403	1	398
QDM11667.1	7.34e-129	29	403	27	396
QUT78083.1	7.34e-129	29	403	27	396
QGT73498.1	7.34e-129	21	403	19	396
CBK68198.1	1.18e-128	29	403	10	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.15e-95	63	402	23	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	8.12e-60	62	402	38	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.42e-59	62	402	28	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	7.25e-19	64	405	81	414	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3PMM_A	9.27e-10	63	357	66	342	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.45e-59	62	402	38	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	5.55e-40	174	400	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.55e-40	174	400	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	9.68e-12	63	323	29	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002082_00053.