CAZyme Information: MGYG000002082_00437

Basic Information

• Species: Alistipes sp900544265
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900544265
• CAZyme ID: MGYG000002082_00437
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42929.63	8.8955

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002082	2573115	MAG	Netherlands	Europe

• Gene Location: Start: 97290; End: 98432 Strand: +

Full Sequence      

MKYFLIAGEPSGDLHGANLIKGLRKADPAAEFRFWGGDLMAAAGGAQNLCKHYRETSFFG
VVQVLRNLDTIRRQMRECREEVAAWQPDVLILVDYPGFNMKMARWAHAHGIRTFYYIAPK
VWASREGRIRALRRDVDRLFVIFPFECDYFPRHGIEPLFEGNPLVDALEARRAALPTPEE
FRRRNGLDPRPIIALLAGSRRSEIRKNLPLMARLAQRFEGWQFVVAGVPWLDRALYEEAA
AESGIRYVCDQTYETLLAAEAAVVTSGTATLETALLGTPEVVVYRLPAIEYRCMPLVVRC
PWISLVNLNLGRESVAEVLQSSLDTTRAERELRAILPGGEKRERMLADFRELRTVIGGPG
ASDRFAARMVELLRAGKPEK

Enzyme Prediction     

No EC number prediction in MGYG000002082_00437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	3.8e-102	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.51e-100	1	378	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.07e-97	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.51e-64	4	352	2	358	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.89e-57	5	372	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.07e-39	1	308	2	285	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL00808.1	1.52e-214	1	375	1	375
BBL11605.1	4.36e-214	1	375	1	375
BBL08813.1	4.36e-214	1	375	1	375
AFL77950.1	2.28e-209	1	375	1	375
BBL06737.1	1.25e-206	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.09e-35	5	372	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	7.06e-35	5	372	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	3.84e-66	5	374	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	1.07e-65	2	377	6	382	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	5.68e-62	2	373	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	9.48e-60	2	373	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	1.17e-56	2	373	8	380	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002082_00437.