CAZyme Information: MGYG000002082_00700

Basic Information

• Species: Alistipes sp900544265
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900544265
• CAZyme ID: MGYG000002082_00700
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
669		74645.95	4.7424

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002082	2573115	MAG	Netherlands	Europe

• Gene Location: Start: 143832; End: 145841 Strand: -

Full Sequence      

MKRIPLFALLASLCALLFCSACGERPVVTSPDGRITLCVAADADGPTWSVEVDGEPLLLP
SRLGVRTRETLIAGTQIASVRHSSFDEEWTQPWGENKLVRNHYNEMAVTLRGAGDVALTL
RARAFDDGVAFRYEWSVAGCDTLAVTDELTEFRFADEPGTLSWSIPGNFETYELQYREQP
VAEVADANTPFTFRTAAGLYGSVHEAALYDYPEMVLRRDSAGVLKADLAPLPDGVKAYVP
ATFTTPWRTVQIGRRAVDLINSALILNLNEPSKIADTSWITPQKYVGVWWGMHLGTQVWT
MGPRHGATTANALRHIDFAAENNIQGVLFEGWNKGWENWGGNQHFDYVEPYADFDLERIA
AYARERGVELWMHAETGGNIPEFERQMEAAMQRYAELGIRTLKTGYAGGFKGGYLHHSQY
GVQHYQRVVETAARYGIMLDVHEPIKETGIRRTWPNMMTREGARGMEWNAWSEGNSAEYL
CTLPFVRLLSGPMDYTPGIFDIDYSRAKADKGRIEWNGPNGDCCIKTTLARQIANWVIIY
SPLQMAADLIENYEGHPAFRFFRDFDADCDWSEALQGEIGDYIVVARRAGERFFLGAGTD
GEARTLTQPLGFLQPGVRYTATIYADAADSAANPEAYRIEERTVTADDTLEIVMAARGGQ
AVTFLPQHE

Enzyme Prediction     

No EC number prediction in MGYG000002082_00700.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	16	664	8.2e-221	0.9920760697305864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	8.14e-136	276	565	1	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	2.09e-81	30	271	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	1.88e-39	569	664	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
pfam01261	AP_endonuc_2	0.001	345	445	9	126	Xylose isomerase-like TIM barrel. This TIM alpha/beta barrel structure is found in xylose isomerase and in endonuclease IV (EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01467.1	0.0	5	666	6	666
CBK63835.1	0.0	10	669	14	671
AFL77433.1	0.0	10	669	14	671
ASB37496.1	0.0	26	666	23	662
QQR08228.1	0.0	26	666	23	662

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	9.96e-171	28	664	3	658	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	9.96e-171	28	664	3	658	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	2.81e-170	28	664	3	658	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	2.13e-138	28	663	5	702	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	2.19e-138	28	663	14	711	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	2.67e-139	1	663	1	722	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	2.25e-58	1	662	1	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	4.15e-38	29	661	44	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000043	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002082_00700.