CAZyme Information: MGYG000002089_00744

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS1826
• CAZyme ID: MGYG000002089_00744
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		32420.5	6.49

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002089	1650359	MAG	Mongolia	Asia

• Gene Location: Start: 70; End: 954 Strand: +

Full Sequence      

MLSSPKRKSPVYLANLPYARTLLELIQQGGYDRIVTPHLFPAEALTHLRKHAGLNVPCYA
VATDYACIPFWEETSLDRYFIPHKDLMPEFIQKGVPESKLIPLGIPVSARFRQHTPRAEA
REALGLPAEGIIYLVMTGSMGYGNVEDMAAELLRRGGTVCVLGGNNRKMKEGLRERFRGN
PRMMVLDFTDQVSLYMDACDVLLTKPGGLTSTEAAVKNIALVHTAPIPGCETVNARFFSQ
RGMSLCGETAGQAAEEAVRLAEDLSLRESMLEAQREQLNPLAADEICDRIAMGI

Enzyme Prediction     

No EC number prediction in MGYG000002089_00744.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	134	278	1.6e-20	0.9299363057324841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	5.50e-60	2	288	69	357	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	8.24e-34	20	290	94	365	diacylglycerol glucosyltransferase; Provisional
PRK13608	PRK13608	1.09e-33	40	287	112	362	diacylglycerol glucosyltransferase; Provisional
PLN02605	PLN02605	3.34e-21	41	291	115	376	monogalactosyldiacylglycerol synthase
pfam06925	MGDG_synth	9.24e-17	3	107	60	169	Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM04818.1	6.16e-106	2	288	74	363
QNM03280.1	6.42e-97	1	290	73	365
ACR75748.1	1.34e-93	1	286	88	376
CBL08784.1	1.29e-88	2	286	74	372
CBL14051.1	1.29e-88	2	286	74	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	8.48e-13	19	290	96	376	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9DQ98	8.56e-31	40	281	112	352	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=ugtP PE=3 SV=1
Q5HQE7	1.60e-28	40	278	112	349	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=ugtP PE=3 SV=1
Q8CPR3	3.06e-28	40	278	112	349	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=ugtP PE=3 SV=1
Q49WE6	1.56e-27	22	287	96	362	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=ugtP PE=3 SV=1
A8FED1	3.70e-27	6	270	82	345	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002089_00744.