CAZyme Information: MGYG000002091_00410

Basic Information

• Species: UBA4644 sp900763355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; UBA4644; UBA4644 sp900763355
• CAZyme ID: MGYG000002091_00410
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000002091_10|CGC1	43830.78	9.8023

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002091	1825873	MAG	Mongolia	Asia

• Gene Location: Start: 23086; End: 24282 Strand: +

Full Sequence      

MDLSLLLTILLSALKVITLYFAGVFLLYGWRKPAAIPRAEARTRFAVVIAARNEETVIPR
LVESLRRQNYPRELFDIYAVPNNCRDNTAGAAFQAGAEVLLCTGTVKNKGDALRQAFAQL
RAEQYDAYVVFDADNVADPEFLARMNDAFCAGARVAKGRQLAGNPGDSWVAGCYDVYFRA
FDRFFNRPRACGGLSAKLVGTGFALRREVLEEVLGGWNTETLAEDAEAAAQCALAGERVF
WVPQAVTWDEEPLTLRNSLRQRRRWCSGILSVSRRMLPRFFRGEGSALRLDMSLFLLTPY
AQGAGALLGLGLGAWKLLTGGVQAWAFMLGGGALAYGVMAALAFVLSAQRGKKRWQAALS
FPLFMATWAPLQILALFHRTRVWKEIPHAGLARPADLA

Enzyme Prediction     

No EC number prediction in MGYG000002091_00410.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	44	266	9.6e-31	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	8.14e-57	47	225	1	180	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	2.57e-34	47	225	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.09e-33	16	386	22	406	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	5.56e-21	44	265	3	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04192	GT_2_like_e	3.10e-17	47	268	1	229	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ39935.1	1.51e-117	12	393	13	403
ADO38773.1	1.10e-71	29	397	30	410
ARD65366.1	1.10e-71	29	397	30	410
ALU13522.1	4.34e-71	29	397	30	410
QCT71577.1	4.34e-71	29	397	30	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	7.27e-08	109	290	214	396	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	7.52e-08	109	290	226	408	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	7.52e-08	109	290	227	409	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	3.21e-06	23	263	15	260	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	3.22e-06	23	263	16	261	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.60e-21	44	300	50	311	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	2.70e-12	47	316	112	384	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	3.44e-10	46	300	109	366	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	4.57e-10	46	300	109	366	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q9ZQN8	4.89e-08	109	288	194	374	Glucomannan 4-beta-mannosyltransferase 7 OS=Arabidopsis thaliana OX=3702 GN=CSLA7 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
292	314
324	346