CAZyme Information: MGYG000002095_00454

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-83
• CAZyme ID: MGYG000002095_00454
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MGYG000002095_12|CGC1	53578.78	6.0675

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002095	1395290	MAG	Mongolia	Asia

• Gene Location: Start: 26377; End: 27813 Strand: +

Full Sequence      

MNILFAASEAAPFCKTGGLADVVGSLPVALAKNTADNVAVILPLYSQIPDTWRRQMTFLR
YIYIDVAWRHQYCGLFSLKHRGVTWYFVDNEQYFHRDNLYGDYDDGERFSFFSRAVVSLL
PSLETMPDVIHCNDWQTALVPVYLRDMAVRWESVRRIKPVFTIHNIEYQGRFGESFLQEV
AGLDEGWWNDGTLRMDGDINLLKGALLVSDRVNTVSPTYAMELRESTYAHHMESVIASLG
DKMTGILNGIDTESYDPATDPALARSYRAGATGGKTGGKALCKRALQREMGLHEEPDTPI
ISIVSRLVGHKGVDLVCQAFDGIMETGAQVVILGKGEAGYEDFFRGKAAQYPGRVAAQIT
YAEDLSRRIYSGSDFLLMPSRSEPCGLSQMIAMRYGTVPIVRRTGGLADSVRSCQLAQPD
GTGFLFDRYDAGDMLCVIRQATDLYQGDRKGYRTVQKNGMSSDFSWERSAREYRKLYE

Enzyme Prediction     

No EC number prediction in MGYG000002095_00454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	478	1.4e-172	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	1	478	1	476	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	1	478	1	471	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	1	478	1	461	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	478	1	473	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	2.82e-110	1	477	4	476	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK78906.1	3.63e-219	1	478	1	473
BCK80926.1	3.51e-212	1	477	1	467
QUO35272.1	7.54e-207	1	478	1	467
QNL45767.1	2.91e-195	2	478	22	493
QUO39419.1	2.47e-191	1	477	1	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QZS_A	7.58e-94	1	477	1	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	5.95e-93	1	477	1	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
3D1J_A	1.33e-92	1	477	1	473	ChainA, Glycogen synthase [Escherichia coli]
1RZU_A	1.97e-79	1	477	1	472	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNE_A	1.39e-78	1	477	10	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7GK04	3.74e-143	1	478	1	472	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
A4IS20	3.11e-142	1	478	1	472	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	1.25e-141	1	478	1	472	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
B9J2G5	2.13e-140	1	478	1	472	Glycogen synthase OS=Bacillus cereus (strain Q1) OX=361100 GN=glgA PE=3 SV=1
Q632H4	2.13e-140	1	478	1	472	Glycogen synthase OS=Bacillus cereus (strain ZK / E33L) OX=288681 GN=glgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999172	0.000839	0.000009	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002095_00454.