CAZyme Information: MGYG000002099_00193

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1750; UBA7102
• CAZyme ID: MGYG000002099_00193
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	MGYG000002099_1|CGC2	70917.54	5.1392

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002099	3139636	MAG	Mongolia	Asia

• Gene Location: Start: 198558; End: 200441 Strand: +

Full Sequence      

MINQAIFNRTPLAPNAFAPLPVGAVKPRGYLLSVERMMASAITGNLPRVWDSMRDNAWMG
GKGESWERGPYYLDGLLPLAWQLGDEELKNTAMKFVEWTLSSQREDGFFGPADNEDWWPR
MVMLKCLQQYFTATGDKRVLSFMNRYFAYMYRNLDEKPLGLWAIARAGDNIQIVQWLYNI
TGQKALLKLCDKLLEQSIDWTGYFHTFPDARDQKRAFPWSLLKPMLDESSDPWSPGWQQH
QHTHVVNLAMALKTPMLDYALHGGIKQAEAFKTGWAKLMRAHGLALGMFSGDEHLSGANP
SQGTETCAVVEMMYTLESLMALSDDPSLGDIWERLAYNALPACLSSDGWAHQYNQQVNQI
RIDRRKRDWYNTNEDANVFGLEPNFGCCTANLHQGWPKFTAHLWMASQDGGLVAQSYAPC
QVTWAIGGTKVRIEVEGNYPANGEVNIRIHAEQPTAFPIRLRIPAWAKDAKASIGGENFF
ADEGTYLTLERTWQEGDEVRLTLPMDVRTEKWYHQSVAVVRGPLLYALPVEAQWDYRGEL
PLCDRWAEPVGKWNYALLPEEGFEADEAGTRIEATAFICEEWKEVRGSAGQPPVSPLRGE
AAKETITLVPYATAPLRIAQFPCGREE

Enzyme Prediction     

No EC number prediction in MGYG000002099_00193.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	129	527	9.2e-42	0.75

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.69e-58	71	527	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.49e-36	80	528	76	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE95537.1	2.30e-144	2	622	25	646
AOM80627.1	9.84e-134	6	622	23	643
ACU60445.1	1.09e-133	6	622	29	649
ALL07583.1	4.14e-130	4	622	27	649
QHS59113.1	3.31e-128	7	622	30	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	5.48e-27	85	528	95	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.64e-24	85	528	95	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002099_00193.