CAZyme Information: MGYG000002099_00342

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1750; UBA7102
• CAZyme ID: MGYG000002099_00342
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	MGYG000002099_2|CGC3	24282.77	4.4861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002099	3139636	MAG	Mongolia	Asia

• Gene Location: Start: 132889; End: 133536 Strand: -

Full Sequence      

MTAKKKGQKVTKRQIWLAVSAVAIGLLAVAICWAFRWAPKKQEIVYPLDYEQELLSAADE
FSIDPCLLAALVYCESSFRPDAVSSVGAVGLMQIMPETGRWLSGKIELDAPYDDEMLYDP
ATNLRLGCWYLDFLHKRYDGRWQEALTAYIAGQGQVDQWLTDPELSKDGKTLDVIPGQDV
KEYAAKVMRTHEKYKTAYPYVLVCTLDDDDDGLQE

Enzyme Prediction     

No EC number prediction in MGYG000002099_00342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	63	195	1.3e-30	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.77e-67	47	193	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.86e-42	46	195	2	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.33e-36	65	189	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.21e-32	57	160	4	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	9.11e-29	15	198	102	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKL94923.1	2.70e-46	36	198	30	188
AOY78357.1	4.70e-45	36	198	21	179
ARE87147.1	7.57e-45	36	198	37	195
VTQ87399.1	1.27e-44	12	198	2	183
AEM78392.1	3.52e-43	45	198	30	182

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	6.21e-18	46	198	412	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.22e-18	46	198	416	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.25e-18	46	198	422	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	6.26e-18	46	198	426	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	6.29e-18	46	198	432	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64046	4.68e-14	46	193	1418	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.68e-14	46	193	1418	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O31608	8.09e-14	51	187	61	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
B0BSH0	4.25e-11	58	194	205	361	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) OX=434271 GN=mltC PE=3 SV=1
B3GYW8	4.25e-11	58	194	205	361	Membrane-bound lytic murein transglycosylase C OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999986	0.000036	0.000003	0.000000	0.000000	0.000012

TMHMM  Annotations     

start	end
16	38