CAZyme Information: MGYG000002099_01331

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1750; UBA7102
• CAZyme ID: MGYG000002099_01331
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39226.3	4.9116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002099	3139636	MAG	Mongolia	Asia

• Gene Location: Start: 44512; End: 45570 Strand: +

Full Sequence      

MMEEQIRARRLPPLFDGEVNAQNFDEWRKNIVDLYAHECFGVTPPAPREVRAVVAEQNDD
DWAGKAEHRKVMLSFDMENGEFSFPVHLVIPKAGRPCPCVVYPSFTPYATAGYQPIEEIV
DQGFALAVFCYEDVTRDNEDFTDGLAAMTSRGAADDWGKIGMWAFACSRVLDHLLTLPEI
DGSRVAVLGHSRLGKTALWAAAQDLRFAAVHSNDSGCAGAAVCRGKVGESVQAIYSQFPF
WFCENYKKYGGQEELLPFEQYQLLACTAPRPLYVASASEDEWADPQSEFLSAVLASPAWA
LFGYEGLGTDKMPAPGGRIASGRVGYHLRPGTHYLSRYDWVRALNFFRLNLR

Enzyme Prediction     

No EC number prediction in MGYG000002099_01331.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	21	349	1.6e-68	0.9219330855018587

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1506	DAP2	4.75e-04	170	250	460	530	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	3.39e-93	1	348	1	358
ALL53565.1	8.90e-84	2	346	4	354
QHT60959.1	5.01e-80	1	346	1	362
QDU37053.1	7.93e-80	28	352	65	432
AEW47971.1	1.03e-78	3	346	27	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	7.91e-66	115	346	156	392	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	1.26e-65	115	346	174	410	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	1.89e-65	115	346	185	421	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	3.52e-65	115	346	174	410	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
7B7H_A	9.80e-65	115	346	174	410	ChainA, Putative acetyl xylan esterase [Opitutus terrae PB90-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	6.24e-57	111	346	183	422	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
P0CU53	7.45e-15	100	289	120	324	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
G0RV93	7.03e-14	152	303	237	396	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
P0CT88	1.43e-13	12	303	47	336	4-O-methyl-glucuronoyl methylesterase 2 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.11.1537.1 PE=1 SV=1
K5XDZ6	6.21e-13	12	303	47	336	4-O-methyl-glucuronoyl methylesterase OS=Phanerochaete carnosa (strain HHB-10118-sp) OX=650164 GN=PHACADRAFT_247750 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002099_01331.