CAZyme Information: MGYG000002101_01808

Basic Information

• Species: Sutterella seckii_A
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella seckii_A
• CAZyme ID: MGYG000002101_01808
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002101_80|CGC1	41252.93	5.3419

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002101	2568007	MAG	Mongolia	Asia

• Gene Location: Start: 5224; End: 6327 Strand: -

Full Sequence      

MKKTLLMSVFAAALALQALPANAWKLWDDFKASNIETARVVDYSDSRRITTSEGQSYALF
FALVANDRTAFAALSDWTEKNLSAGDITKALPSWLWGQTRAGDRNAWGVIDTNNAADSDM
WIAWCYLEAGRLWNKSEYTAKGRAMLELLKKEVRDVENLGKVILPGRVGFEDKNGTVKLN
PSYYPLFILRRFALEDAYWTDVYDGSLRMLLRSAPSGFAPEWARFTNQGRLVTPDATDYT
EGSYNAIRTYMWAGMMSPEDPGRFPLVERFQPMVDATRKLNFPPEKVNVVTADVEAPGPA
YFGACLLSLLGNDRTAGLIRTVLSAEGVTRDRYYGNVLVLYGLGFDEGRFLFDRDGRLVI
RMEEAQK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	24	345	3.8e-73	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	8.74e-141	24	365	25	371	cellulase.
COG3405	BcsZ	4.67e-80	24	352	26	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	6.38e-55	27	348	8	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53874.1	4.37e-265	1	367	1	367
QQS88762.1	1.94e-176	1	367	5	368
ANU67169.1	8.49e-114	1	360	1	350
QQQ96024.1	8.49e-114	1	360	1	350
AMJ68802.1	1.44e-99	12	359	10	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2B_A	9.12e-92	21	359	1	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
3QXQ_A	1.56e-91	21	359	1	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F81_A	4.40e-90	21	358	5	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	1.25e-89	21	358	5	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	2.04e-86	21	359	1	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZLB7	2.48e-96	15	359	17	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	3.99e-95	15	359	17	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
Q8X5L9	4.97e-93	1	359	4	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	1.13e-91	12	359	15	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	1.41e-69	11	359	21	372	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000436	0.998790	0.000218	0.000174	0.000179	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002101_01808.