CAZyme Information: MGYG000002106_01280

Basic Information

• Species: Parolsenella sp900552935
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Parolsenella; Parolsenella sp900552935
• CAZyme ID: MGYG000002106_01280
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000002106_111|CGC1	38987.19	5.304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002106	1667954	MAG	Mongolia	Asia

• Gene Location: Start: 601; End: 1662 Strand: -

Full Sequence      

MLKARKRDVENRRLRGVNLSGWLVLEPWVTPSLFAGTGAFCEAELASVMEDSRYAELLER
HRSTFIDEGDFARIVSRGYDAVRLQVPWYVFGEVGPMPGPSEGCLDYVDRAFDWAEAAGI
EVLLDVAVVPGTDSASPASFFGDVASFRRAVIDVAAALASRYAERENFLGIEPIGAIKGR
SRRGLSVVEGVPPHLLRNFYRDAYEAVREAAGTRPIFVVNDAGLPDAWRAFMSPARYENV
WLDSHVFHYSDSMNAAGPTGVRRLVKDTEQYLARTKKSGLPVMVGEWSSALPLADAGMTP
EGRIALERVFTAGQMSAFSGCVGWFFQTWKTEGRLSSWDARVALSSFEHGMLE

Enzyme Prediction     

No EC number prediction in MGYG000002106_01280.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	60	305	1.3e-40	0.8642384105960265

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	9.52e-16	6	332	10	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.39e-05	65	287	24	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH50588.1	1.19e-204	3	353	10	360
ADK68544.1	6.73e-130	12	352	4	346
BCV19183.1	6.73e-130	9	353	1	347
SDR87855.1	2.93e-126	9	352	1	346
AKT48931.1	7.56e-124	12	352	4	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	6.43e-36	13	330	2	358	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	1.72e-35	13	330	2	358	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	1.52e-24	8	332	3	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3N9K_A	2.20e-24	8	332	8	367	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1CZ1_A	2.85e-24	8	332	3	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1D4Q5	2.82e-37	11	346	39	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
B0XN12	5.44e-36	11	346	39	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q4WK60	7.55e-36	11	346	39	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
A1CRV0	1.99e-35	8	346	36	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
Q7Z9L3	1.20e-34	8	339	25	382	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002106_01280.