CAZyme Information: MGYG000002108_00619

Basic Information

• Species: Prevotella sp900290275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900290275
• CAZyme ID: MGYG000002108_00619
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	MGYG000002108_12|CGC3	93864.63	7.3475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002108	2842572	MAG	Mongolia	Asia

• Gene Location: Start: 36150; End: 38720 Strand: +

Full Sequence      

MKKFAYSLVLYFCACTWGFVQPMQAQLYKDSSRTAEERAADLLKRMTLEEKIAQIRHIHS
WDVFDGQRLDTGRMRSFVGDCCWGFVEGFPLTGESCHNNMNRIQKYMVDSTRLGIPVFTV
AEALHGSVHEGSTIFPQNIALASTFNPNLAYRRAQAIAGELHYEGIRQILAPCIDVVRDI
RWGRVEETFGEDPFLNAAFACEEVRGYLDNGISPMLKHFGAHGNPMGGLNLASVNCGVGE
LHDVYLYPFRKVITTLPVQAVMSTYNSWNRVPNSSSRYLLTDVLRDKWGFKGYVYSDWGA
IDMLYTFQRTASSQAEAAVQALSAGLDVEASSECYPKLIGLVKEGKFDVRLIDEAVRRVL
LAKFRAGLFEDPYGKRYASSAQLRSVANASLAREIAEESAVLLKNDNHLLPLNLSQLGSV
AVIGPNADQVQFGDYSWSRSNKDGITPLSAIRSMADKHGVKVRYARGCNLMTTDTSHIAE
AVSAAKMSDVAIVFCGSASASLARDYGGANCGEGFDLSSLSLTGAQSDLIRAVKATGKPV
VLVLVTGKPFAIAWEKANVESIIVQWYAGEQEGNAIADILFGKVNPSGHLTVSFPQSAGH
LPAYYNYLPSDRGFYHKHGSYTSPGRDYVFSSPDALWSFGHGMSYTTYAYSNMRVDAQAD
SVKVYVDVANTGDVAGKAVPQLYVRDMYSSVATPVKQLKAFNKVYLQPGERARVALHFAV
ADLAFTDEKGDSRVEPGDFELQVGESSDSILLRDTINIGGMSVDKTEQMVQTVAVKTKGR
IIKITGVVRDVQATPIEGVEVYSAGTKRVVALTAKSGKYTAEVASDDVLIFRRSGLIDES
LQVDGRKAINVKMRNK

Enzyme Prediction     

No EC number prediction in MGYG000002108_00619.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	109	329	3.2e-67	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.12e-161	34	750	30	757	beta-glucosidase BglX.
PLN03080	PLN03080	1.42e-90	112	752	78	777	Probable beta-xylosidase; Provisional
COG1472	BglX	2.08e-88	46	438	1	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.46e-67	47	360	1	314	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	6.17e-64	400	645	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA30647.1	0.0	9	855	13	856
QUT62191.1	0.0	9	855	13	856
QUT33795.1	0.0	9	855	13	856
QDO71585.1	0.0	22	855	12	845
BCI64332.1	0.0	24	853	37	868

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	9.52e-149	28	750	7	748	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	7.38e-148	28	750	7	748	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	2.24e-136	28	750	36	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	4.26e-108	34	747	1	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.27e-107	34	747	1	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	8.92e-117	20	747	15	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.84e-115	20	747	15	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	9.72e-114	112	747	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	5.31e-109	1	747	1	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P14002	7.74e-87	112	758	34	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001172	0.545333	0.452781	0.000279	0.000214	0.000193

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002108_00619.