CAZyme Information: MGYG000002108_00724

Basic Information

• Species: Prevotella sp900290275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900290275
• CAZyme ID: MGYG000002108_00724
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000002108_15|CGC1	54704.82	9.0998

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002108	2842572	MAG	Mongolia	Asia

• Gene Location: Start: 36583; End: 38013 Strand: -

Full Sequence      

MFKEFILYAYGYLVFFYSLALIASYVMLIWLAYIEQRKHHNAMSDSYVKQIFRHSPYTPG
VSIVASAYNEEKTIVNNIKSLLSQDYPKFEIVIVNDGSKDNTLQEMIDNFDLVETPYNYR
MRISAKPFKRLFTSTNPKYQRLRVVDKVNGGTKADAVNGGLNVARYPYFINTDVDCILAK
DAIMKCVRPMIEMNDVIAVSGVMNMSNGSLVEDGELIEYRIPWSPIPLFQTLEYLRSFMV
GKMGWSAINAMPNVSGGYGMFDTEVAIAAGGYSSDSLAEDEDMLIRMIGYCCDFNRKYRV
VQIPDTCCWTEGPSNLKILNRQRTRWGHGLIQTFSKYNRMMFKKKYRQLGLISMPHQFIF
ELLAPVIEFVGLLTTIYLAFTGGVNWGTAAIIFAVMYVFCVQLSFVVIYYDYTQTKMKGY
AYLRLIVAALLEPFVYHPFIVFFSLRGYMKFITKQRIVWGEMTRQGFAKKPNQVAS

Enzyme Prediction     

No EC number prediction in MGYG000002108_00724.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	62	209	1.6e-20	0.7235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.25e-54	63	280	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	3.72e-46	1	471	1	431	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	3.17e-32	5	423	5	378	N-glycosyltransferase; Provisional
PRK14583	hmsR	2.46e-21	13	398	33	383	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd02525	Succinoglycan_BP_ExoA	1.16e-20	61	349	2	243	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74207.1	5.82e-195	3	474	2	476
QIU93724.1	6.07e-193	3	470	2	472
CBK67631.1	3.88e-191	10	470	9	472
QUT31986.1	3.88e-191	10	470	9	472
QUT26577.1	3.88e-191	10	470	9	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	6.43e-07	59	102	13	58	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKQ0	1.77e-17	60	329	48	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	3.18e-17	60	329	48	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q9RQP9	3.38e-15	60	329	48	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q99QX3	3.38e-15	60	329	48	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q5HCN1	3.38e-15	60	329	48	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
349	371
386	408
420	442