CAZyme Information: MGYG000002108_01542

Basic Information

• Species: Prevotella sp900290275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900290275
• CAZyme ID: MGYG000002108_01542
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		45609.74	9.9984

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002108	2842572	MAG	Mongolia	Asia

• Gene Location: Start: 6932; End: 8131 Strand: -

Full Sequence      

MKFLKTTYLLVLLLALTACRDIATDGQAVVRNGNTTYRGGIKDGKYDGYGQLSIGDSIVY
AGEWRMGKRCGKGVSHDSLHHRIVGIWRADTLVGGTWTDSTGTYSGEMNQDAIAQGYGSF
ADPNRNLYVGSWKDGKRTGFGFDITSKRHVRAGEWRADRFLGERLEYTADRIYGIDISRF
QHDKGRRHYPIDWSKIRISHLGNISRKHVTGKVDYPVSFCYIKSTESTSIRNRYYRADYL
SARGRGIKVGAYHFFSTRTLASTQARFFIKNSIFRKGDLPPVLDVEPTHQQIKAMGGPNA
LFRAVRTWLRMVGEHTGTKPVLYISQSFVNRYLSLAPDLKRDYNIWIARYGEYKPDVHLV
YWQLCPDGRVSGIHLEVDINVFNGYRNEYNEFLSRECIK

Enzyme Prediction     

No EC number prediction in MGYG000002108_01542.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	191	373	4.9e-37	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	6.15e-41	173	384	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	6.01e-37	172	384	3	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	2.39e-36	173	382	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.34e-34	191	373	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	8.68e-32	157	394	50	265	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48884.1	2.28e-163	33	398	37	402
AGB29361.1	1.35e-152	30	394	45	408
QUB47627.1	3.41e-141	21	394	30	403
BCS86499.1	2.16e-140	41	398	1	357
VEH15425.1	2.29e-140	49	394	31	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	1.45e-19	172	392	16	216	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	7.65e-15	172	384	5	204	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X7H0	1.52e-28	172	394	67	266	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P76421	2.11e-28	172	394	67	266	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	2.11e-28	172	394	67	266	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P25310	1.26e-13	172	384	82	281	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P34020	1.60e-07	211	383	11	181	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000010	1.000046	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002108_01542.