CAZyme Information: MGYG000002108_01600

Basic Information

• Species: Prevotella sp900290275
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900290275
• CAZyme ID: MGYG000002108_01600
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000002108_54|CGC1	74132.02	7.0168

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002108	2842572	MAG	Mongolia	Asia

• Gene Location: Start: 12850; End: 14823 Strand: +

Full Sequence      

MNNSLRNLLAALLLATVSTGAFAEQNKVISPDGRLVVNVEDHAGCLYYDVTYDGKQMMQP
SLLGVVANVGDFSQNLVYKSVDKCKVENSYTMRSTKASLVHYKANEMNLTYINDKKLPVI
VKFRVSDNDIAFRYEFGEVNDRTHILIDQEKTAFRLPSQTTTFLSPQSDPMIGWKHSKPS
YEEEYTPDAPLTAKSKYGKGYTFPCLFHVGNDGWVLVSETGTHGNYPGCRLSDYSADKGY
TVEFPMQGECDGRGASNAAFTLPGATPWRTITVGSSLKPIVETTVSYDVVEPMYKASEQY
KPGRYTWSWLIWQDNSANYDDQKQMVDLAATMGYEYVLVDGLWDQQTGRERIAELSRYAQ
SKGVSLMLWYNSNGTANEAPQTPRNCMNTVIARKKEMRWMQSIGVKGIKVDFFGGDKQHV
MQLYEDILSDANDYGLQVIFHGCTLPRGWERMFPNYVSSEAVLASENVFFQEHHAKQEVF
ELTMHPFCRNTVAAMDWGGTIMNRYMSRDNKSRHRRYTSDVFEMAAAIVNQASIQCIAMY
PNNLSELPQHEIDFLKSVPTTWDETRFVDGYPGKYAVVARRHGDKWYVAALNGTNKPLSL
NLSLPMLAGKQVTYHYETADKKSLWPKSDVKTTKVGKDGKLKIVMQPMGGNIVLGEA

Enzyme Prediction     

EC	3.2.1.22	3.2.1.88

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	15	653	3.3e-168	0.9889064976228209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.81e-82	301	559	6	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	2.03e-68	30	292	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	7.46e-25	562	650	1	91	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67049.1	0.0	6	653	3	651
QIM10245.1	9.12e-294	12	653	9	659
BCS85824.1	1.14e-290	11	653	10	655
QVJ79926.1	5.79e-283	9	653	7	644
ADE81436.1	2.71e-281	8	653	7	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XFM_A	5.26e-245	48	650	40	637	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3WFA_A	2.03e-35	25	611	2	655	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2D73_A	2.14e-35	25	611	22	675	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]
2JKA_A	8.76e-35	27	611	13	664	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	2.10e-46	1	588	1	559	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	3.65e-35	6	611	4	675	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.998955	0.000198	0.000188	0.000178	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002108_01600.