CAZyme Information: MGYG000002109_01789

Basic Information

• Species: UBA1232 sp900544815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; UBA1232; UBA1232 sp900544815
• CAZyme ID: MGYG000002109_01789
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	MGYG000002109_53|CGC1	50982.96	9.6772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002109	2245017	MAG	Mongolia	Asia

• Gene Location: Start: 9297; End: 10661 Strand: +

Full Sequence      

MHCILNLLYDIGMRGYSLAAKIAAPFNDKAKLFCKGRKGLLARIVQTVKSDAPIVWFHAS
SVGEFEQARPIIEWYKANAPQYRILLTFFSPSGYELRKNYDMADWVFYLPIDTSSNARRF
VEAVKPQKAIFIKYEFWYNYLTTLKRFGTEVYIVSAIFRRSQPFFKWYGSLFRKMLGTYS
HLFVQDDNSAALLAEVGIKENVTISGDTRFDRVYKITKSSNNLPLVDAFVRVGMPSSFAG
ITPAAQAVTTTKTTNSLILVAGSSWPPDEALIARILENFSKIRLVLAPHEIGKDHLTAIE
RTFSIYNPVRYTQLNERFVNSAEGSEEREAICKQLSCSRVLIIDCIGILSSIYKYGHVAY
IGGGFGVGIHNILEAATYGIPIIFGPNYKKFKEARDLIALGGATSIENCSNLYDITNKFV
NNRSVIVEKGAVCKNYVLSNIGATRKVVSTIEKL

Enzyme Prediction     

No EC number prediction in MGYG000002109_01789.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	43	212	3.2e-45	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	3.04e-57	7	454	4	420	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	5.89e-56	13	454	2	418	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	9.90e-55	49	212	10	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY52844.1	3.11e-131	27	454	8	403
AHW59437.1	5.95e-130	5	451	1	408
QGA23522.1	1.08e-129	5	451	1	407
QNR87260.1	4.27e-128	7	453	3	411
CEA16643.1	2.47e-127	8	451	1	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	3.78e-21	46	403	34	326	Membrane-embeddedmonofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0CE14	7.59e-24	48	430	51	404	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=waaA PE=3 SV=1
Q3KMF4	1.03e-23	48	430	51	404	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) OX=315277 GN=waaA PE=3 SV=1
B0B9V8	3.47e-23	48	430	51	404	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) OX=471472 GN=waaA PE=1 SV=1
Q9PKI5	3.87e-22	48	430	50	403	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=waaA PE=3 SV=1
F0T4D1	1.08e-20	48	431	54	407	3-deoxy-D-manno-octulosonic acid transferase OS=Chlamydophila psittaci (strain ATCC VR-125 / 6BC) OX=331636 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002109_01789.