CAZyme Information: MGYG000002113_00216

Basic Information

• Species: Anaerovibrio sp900548165
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Anaerovibrio; Anaerovibrio sp900548165
• CAZyme ID: MGYG000002113_00216
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000002113_7|CGC1	38791.69	8.5357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002113	1986108	MAG	Mongolia	Asia

• Gene Location: Start: 2332; End: 3357 Strand: +

Full Sequence      

MCMRRIFILLCLLMVWAESALAAGNLGVLWDWQAPGEKESRLVQQAKLPGIDVLSPSWFI
IENAQGKIKTRHGSVKYVRQAHNKGYQVWALITNNFDPQMTSKLLDSPLARKRVIAQMEQ
LAKDYELDGFNLDFENINPADKDKLTDFVQEISKALKPQGLIISIDVTIPSNSGYWSKCY
DRKAIAEVVDYVMLMAYDEHGAGSEVSGSVASLPWVEDGIQKNLQEGVPEKKLILGMPLY
MRLWQETKGKVKAKTLSMAQADKVIQEKGLVPVWLSKEGQYYFEYQEKNTRYRVWQENRR
SLALKASLVNRYNLAGGAYWRSTLETEDVWPALAETLSYGK

Enzyme Prediction     

No EC number prediction in MGYG000002113_00216.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	65	322	9.6e-45	0.7736486486486487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	9.96e-89	45	333	20	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.46e-55	76	333	151	418	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	4.80e-34	102	320	80	302	Glycosyl hydrolases family 18.
smart00636	Glyco_18	1.22e-31	102	320	83	329	Glyco_18 domain.
cd06549	GH18_trifunctional	1.79e-29	46	329	19	295	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB47041.1	1.38e-134	24	333	49	357
QIB60827.1	1.66e-102	32	337	42	346
BDA10778.1	5.38e-101	32	337	42	346
SNU93874.1	5.56e-101	32	337	39	343
QJW48079.1	8.60e-98	24	337	165	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	1.60e-24	91	324	76	310	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	1.38e-22	107	338	85	315	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	1.28e-20	32	320	10	327	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
4S3K_A	4.13e-19	96	341	182	431	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	2.04e-17	91	341	172	429	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	1.57e-33	76	333	75	339	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O31682	2.30e-25	51	263	26	231	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
O05495	2.27e-23	91	324	168	402	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P37531	6.63e-21	96	341	178	427	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	8.17e-17	91	341	171	428	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999119	0.000167	0.000167	0.000147	0.000142

TMHMM  Annotations     

start	end
7	29