CAZyme Information: MGYG000002115_00271

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110
• CAZyme ID: MGYG000002115_00271
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000002115_4|CGC1	54501.96	5.2663

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002115	2270238	MAG	Mongolia	Asia

• Gene Location: Start: 13071; End: 14501 Strand: -

Full Sequence      

MKIAMVASEAAPFVKTGGLGDVMQALPEELSRIKGNELVLLLPYYKKLKQDPNLPVEYVG
SFNMELAWRESYVGILRLKSRRKKLQIYFIDNDYYFGARNSIYGDFDDGERFAYFSKAVL
ATLYYLDFKPEILHCHDWQAAMAVVYYRALYHDWSPETKTVFTIHNVEYQGWADEAFFDN
TLGLPEEYRAKLTFDGAINMMKGAIEVSDIVTTVSKSYADELRYPYYAHRLDGVLRNAWL
WGITNGINTETFNPETDKAIGTHYSAAHMEGKWENKRALREELGLRTDTDAPILAMVTRL
AGHKGIDLLCYIFQRLMEREVQLVVVGTGDRQYEYALSAFARQYPGRVAVRLCFDQELAS
RIYAGADMYLMPSKSEPCGLSQLIAMRYGTVPIVAATGGLRDTVPPYNNETKEGRGFTFQ
SYNADDFLGAIDRAVGLYYGAREEWNELAKRDMECDFSWQQPAAEYMQLYTELRSK

Enzyme Prediction     

No EC number prediction in MGYG000002115_00271.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	471	3e-165	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	472	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
TIGR02095	glgA	0.0	1	473	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	1	476	1	466	glycogen synthase GlgA.
COG0297	GlgA	9.37e-171	1	476	1	481	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14098	PRK14098	2.01e-109	2	476	7	489	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX62809.1	1.60e-148	1	473	1	472
QYF80556.1	7.37e-148	1	473	1	473
AZV59677.1	7.37e-148	1	473	1	473
QOS89474.1	4.20e-147	1	473	1	473
QNK47233.1	2.73e-145	1	473	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	1.13e-84	3	476	12	500	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	2.30e-78	1	474	1	477	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	3.98e-78	1	474	1	477	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	3.07e-77	1	474	1	477	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	7.07e-75	1	476	1	478	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2V049	8.52e-140	1	473	1	475	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	4.84e-139	1	473	1	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1
B7HBC4	2.08e-137	1	473	1	474	Glycogen synthase OS=Bacillus cereus (strain B4264) OX=405532 GN=glgA PE=3 SV=1
Q816G8	2.08e-137	1	473	1	474	Glycogen synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=glgA PE=3 SV=1
Q6HC18	8.33e-137	1	473	1	474	Glycogen synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002115_00271.