CAZyme Information: MGYG000002121_00546

Basic Information

• Species: Acidaminococcus sp000437815
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Acidaminococcus; Acidaminococcus sp000437815
• CAZyme ID: MGYG000002121_00546
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		46261.05	9.3621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002121	1985893	MAG	Mongolia	Asia

• Gene Location: Start: 15849; End: 17060 Strand: -

Full Sequence      

MMYVLTFIVQLLLVLTFLWTCSTVFLGLVTRRKKRPVVAGPSRFAVLVCAHNEANVVGKL
FQSLEDQDYPGELYRVFLLADHCDDATAEVGRRYPHVTVLERQEGPRTGKGAVLSWGIPR
IRKQYGREFSHIVIFDADNMADRGFLSALDWSFRRGARLVMGNRLPLNPFDNLISQWYSM
YWLSVDLFSKPRYNVDLPGIISGTGFGFDASLLEPDGWHTRTIVEDMEFSMQQNFKGVFS
EYQDKARFYDEQPVTLRGMVSQLRRWMTGNYQIARLYRKEWLAHFRARPDARLIDNFVPM
LMCVVFGFYFLTNVLWVGNRALNGLPPLAGKDILWWIMLYVLSLVMGTCAIKAGDLPVKK
MLPGILTGGFFCIFLSLVAVWSVFFPQKKWIPIAHVHEAGPEK

Enzyme Prediction     

No EC number prediction in MGYG000002121_00546.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	41	268	3.5e-19	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	1.29e-51	46	229	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	1.44e-31	46	226	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.55e-24	11	346	19	354	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06439	CESA_like_1	3.68e-20	24	272	7	250	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
cd06421	CESA_CelA_like	1.14e-13	43	274	2	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADB47583.1	2.87e-270	1	403	1	403
AEQ22674.1	7.37e-180	2	402	1	402
AYH39433.1	6.91e-71	19	398	25	405
AYH39439.1	1.31e-58	19	395	25	400
BCI60981.1	1.26e-55	18	403	24	412

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P74165	1.10e-08	46	272	112	338	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
296	318
333	351
363	385